HPR (haptoglobin-related protein)

Gene

• Entrez ID: 3250
• Gene name: Haptoglobin-related protein
• Gene symbol: HPR
• Synonyms: A-259H10.2, HP
• Chromosome: 16
• Chromosome location: 16q22.2
• Summary: This gene encodes a haptoglobin-related protein that binds hemoglobin as efficiently as haptoglobin. Unlike haptoglobin, plasma concentration of this protein is unaffected in patients with sickle cell anemia and extensive intravascular hemolysis, suggesting a difference in binding between haptoglobin-hemoglobin and haptoglobin-related protein-hemoglobin complexes to CD163, the hemoglobin scavenger receptor. This protein may also be a clinically important predictor of recurrence of breast cancer. [provided by RefSeq, Oct 2011]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT525352	hsa-miR-874-3p	PAR-CLIP	22012620
MIRT525353	hsa-miR-3157-3p	PAR-CLIP	22012620
MIRT525354	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT525355	hsa-miR-4290	PAR-CLIP	22012620
MIRT525356	hsa-miR-5699-3p	PAR-CLIP	22012620
MIRT525357	hsa-miR-4421	PAR-CLIP	22012620
MIRT525358	hsa-miR-6748-3p	PAR-CLIP	22012620
MIRT525359	hsa-miR-1247-5p	PAR-CLIP	22012620
MIRT525360	hsa-miR-6777-3p	PAR-CLIP	22012620
MIRT525361	hsa-miR-483-3p	PAR-CLIP	22012620

Transcription factors

Transcription factor	Regulation	Reference
SP1	Activation	12088866

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002526	Process	Acute inflammatory response	IBA	21873635
GO:0004252	Function	Serine-type endopeptidase activity	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006898	Process	Receptor-mediated endocytosis	TAS
GO:0010942	Process	Positive regulation of cell death	IBA	21873635
GO:0030492	Function	Hemoglobin binding	NAS	2987228
GO:0031638	Process	Zymogen activation	IBA	21873635
GO:0034366	Component	Spherical high-density lipoprotein particle	IDA	16682745
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0072562	Component	Blood microparticle	IBA	21873635

Other IDs

• MIM: 140210
• HGNC: 5156
• e!Ensembl: ENSG00000261701

Protein

• UniProt ID: P00739
• Protein name: Haptoglobin-related protein
• Protein function: Primate-specific plasma protein associated with apolipoprotein L-I (apoL-I)-containing high-density lipoprotein (HDL). This HDL particle, termed trypanosome lytic factor-1 (TLF-1), mediates human innate immune protection against many species of African trypanosomes. Binds hemoglobin with high affinity and may contribute to the clearance of cell-free hemoglobin to allow hepatic recycling of heme iron.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	104 → 341	Trypsin	Domain

• Sequence:

  MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLR
  TEGDGVYTLNDKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAK
  MVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVL
  HPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGRVGYVSGWGQSDNFKLTDHLKY
  VMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDAGSA
  FAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN

• Sequence length: 348