GediPNet logo

HMGA1 (high mobility group AT-hook 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3159
Gene nameGene Name - the full gene name approved by the HGNC.
High mobility group AT-hook 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
HMGA1
SynonymsGene synonyms aliases
HMG-R, HMGA1A, HMGIY
ChromosomeChromosome number
6
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.31
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove o
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000349 hsa-miR-125b-5p Luciferase reporter assay 17563749
MIRT000110 hsa-miR-26a-5p Luciferase reporter assay 17563749
MIRT003152 hsa-let-7a-5p Luciferase reporter assay, qRT-PCR 19179606
MIRT003152 hsa-let-7a-5p Luciferase reporter assay, qRT-PCR 19179606
MIRT001625 hsa-let-7b-5p pSILAC 18668040
Transcription factors
Transcription factor Regulation Reference
E2F1 Activation 22389255
MYCN Unknown 16166307
SP1 Activation 17510387
SP1 Unknown 22389255
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IDA 9253416
GO:0003677 Function DNA binding ISS
GO:0003680 Function Minor groove of adenine-thymine-rich DNA binding IDA 9253416
GO:0003680 Function Minor groove of adenine-thymine-rich DNA binding ISS
GO:0003680 Function Minor groove of adenine-thymine-rich DNA binding TAS 10428834
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P17096
Protein name High mobility group protein HMG-I/HMG-Y (HMG-I(Y)) (High mobility group AT-hook protein 1) (High mobility group protein A1) (High mobility group protein R)
Protein function HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the
PDB 2EZD , 2EZE , 2EZF , 2EZG , 8CPG
Family and domains
Sequence
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Sequence length 107
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412