GNAI3 (G protein subunit alpha i3)

Gene

• Entrez ID: 2773
• Gene name: G protein subunit alpha i3
• Gene symbol: GNAI3
• Synonyms: 87U6, ARCND1
• Chromosome: 1
• Chromosome location: 1p13.3
• Summary: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling pathways. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes an alpha subunit and belongs to the G-alpha family. Mutation in this gene, resulting in a gly40-to-arg substitution, is associated with auriculocondylar syndrome, and shown to affect downstream targets in the G protein-coupled endothelin receptor pathway. [provided by RefSeq, Jun 2012]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs387907178	G>A,C	Pathogenic	Coding sequence variant, missense variant
rs397514768	C>A	Pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002679	hsa-miR-124-3p	Microarray, Microarray;Other	15685193
MIRT023926	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT025197	hsa-miR-181a-5p	Sequencing	20371350
MIRT445888	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT445889	hsa-miR-219b-5p	PAR-CLIP	22100165
MIRT445890	hsa-miR-3691-3p	PAR-CLIP	22100165
MIRT731118	hsa-miR-222-3p	qRT-PCR, Luciferase reporter assay, Immunohistochemistry, Western blot	25444921
MIRT735807	hsa-miR-103a-3p	PAR-CLIP	26701625
MIRT735843	hsa-miR-107	PAR-CLIP	26701625
MIRT737297	hsa-miR-130a-5p	PAR-CLIP	26701625
MIRT737589	hsa-miR-141-5p	PAR-CLIP	26701625
MIRT739183	hsa-miR-23a-3p	PAR-CLIP	26701625
MIRT739193	hsa-miR-23b-3p	PAR-CLIP	26701625
MIRT739203	hsa-miR-23c	PAR-CLIP	26701625
MIRT739704	hsa-miR-3065-3p	PAR-CLIP	26701625
MIRT762043	hsa-miR-1273h-5p	PAR-CLIP	27292025
MIRT762256	hsa-miR-1288-5p	PAR-CLIP	27292025
MIRT762790	hsa-miR-149-3p	PAR-CLIP	27292025
MIRT763049	hsa-miR-1827	PAR-CLIP	27292025
MIRT763288	hsa-miR-1910-3p	PAR-CLIP	27292025
MIRT764581	hsa-miR-30b-3p	PAR-CLIP	27292025
MIRT764658	hsa-miR-30c-1-3p	PAR-CLIP	27292025
MIRT764703	hsa-miR-30c-2-3p	PAR-CLIP	27292025
MIRT764807	hsa-miR-3122	PAR-CLIP	27292025
MIRT766809	hsa-miR-3689a-3p	PAR-CLIP	27292025
MIRT766897	hsa-miR-3689b-3p	PAR-CLIP	27292025
MIRT766985	hsa-miR-3689c	PAR-CLIP	27292025
MIRT767611	hsa-miR-3913-5p	PAR-CLIP	27292025
MIRT767771	hsa-miR-3929	PAR-CLIP	27292025
MIRT768767	hsa-miR-4419b	PAR-CLIP	27292025
MIRT769518	hsa-miR-4478	PAR-CLIP	27292025
MIRT769845	hsa-miR-450a-1-3p	PAR-CLIP	27292025
MIRT769904	hsa-miR-4514	PAR-CLIP	27292025
MIRT770630	hsa-miR-4649-3p	PAR-CLIP	27292025
MIRT771110	hsa-miR-4692	PAR-CLIP	27292025
MIRT771705	hsa-miR-4728-5p	PAR-CLIP	27292025
MIRT772607	hsa-miR-485-5p	PAR-CLIP	27292025
MIRT776786	hsa-miR-6511a-5p	PAR-CLIP	27292025
MIRT776997	hsa-miR-6513-5p	PAR-CLIP	27292025
MIRT777555	hsa-miR-665	PAR-CLIP	27292025
MIRT778886	hsa-miR-6779-5p	PAR-CLIP	27292025
MIRT778977	hsa-miR-6780a-5p	PAR-CLIP	27292025
MIRT779115	hsa-miR-6785-5p	PAR-CLIP	27292025
MIRT779235	hsa-miR-6788-5p	PAR-CLIP	27292025
MIRT779375	hsa-miR-6798-5p	PAR-CLIP	27292025
MIRT779412	hsa-miR-6799-5p	PAR-CLIP	27292025
MIRT779667	hsa-miR-6808-5p	PAR-CLIP	27292025
MIRT780911	hsa-miR-6883-5p	PAR-CLIP	27292025
MIRT780995	hsa-miR-6884-5p	PAR-CLIP	27292025
MIRT781200	hsa-miR-6893-5p	PAR-CLIP	27292025
MIRT781342	hsa-miR-7106-5p	PAR-CLIP	27292025
MIRT781603	hsa-miR-7160-5p	PAR-CLIP	27292025
MIRT782556	hsa-miR-887-5p	PAR-CLIP	27292025
MIRT782894	hsa-miR-940	PAR-CLIP	27292025

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	12642577
GO:0001664	Function	G protein-coupled receptor binding	IBA	21873635
GO:0003924	Function	GTPase activity	IBA	21873635
GO:0003924	Function	GTPase activity	IDA	19478087
GO:0005515	Function	Protein binding	IPI	18434541, 21988832, 25416956, 26126266, 27621449, 28514442, 30194280, 32296183
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	17635935
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	12642577
GO:0005813	Component	Centrosome	IDA	17635935
GO:0005834	Component	Heterotrimeric G-protein complex	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	17635935, 27864364
GO:0005886	Component	Plasma membrane	TAS
GO:0006457	Process	Protein folding	TAS
GO:0006906	Process	Vesicle fusion	IEA
GO:0007049	Process	Cell cycle	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	19478087
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS
GO:0007194	Process	Negative regulation of adenylate cyclase activity	TAS	7608168
GO:0007212	Process	Dopamine receptor signaling pathway	IDA	19478087
GO:0007420	Process	Brain development	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016239	Process	Positive regulation of macroautophagy	IMP	12642577
GO:0019003	Function	GDP binding	IDA	19478087
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030496	Component	Midbody	IDA	17635935
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IBA	21873635
GO:0031821	Function	G protein-coupled serotonin receptor binding	IEA
GO:0032794	Function	GTPase activating protein binding	IEA
GO:0032930	Process	Positive regulation of superoxide anion generation	IEA
GO:0033864	Process	Positive regulation of NAD(P)H oxidase activity	IEA
GO:0042588	Component	Zymogen granule	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0046039	Process	GTP metabolic process	IDA	19478087
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IDA	17635935
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 139370
• HGNC: 4387
• e!Ensembl: ENSG00000065135

Protein

• UniProt ID: P08754
• Protein name: Guanine nucleotide-binding protein G(i) subunit alpha-3 (G(i) alpha-3)
• Protein function: Heterotrimeric guanine nucleotide-binding proteins (G proteins) function as transducers downstream of G protein-coupled receptors (GPCRs) in numerous signaling cascades. The alpha chain contains the guanine nucleotide binding site and alternates between an active, GTP-bound state and an inactive, GDP-bound state. Signaling by an activated GPCR promotes GDP release and GTP binding. The alpha subunit has a low GTPase activity that converts bound GTP to GDP, thereby terminating the signal. Both GDP release and GTP hydrolysis are modulated by numerous regulatory proteins (PubMed:8774883, PubMed:18434541, PubMed:19478087). Signaling is mediated via effector proteins, such as adenylate cyclase. Inhibits adenylate cyclase activity, leading to decreased intracellular cAMP levels (PubMed:19478087). Stimulates the activity of receptor-regulated K(+) channels (PubMed:2535845). The active GTP-bound form prevents the association of RGS14 with centrosomes and is required for the translocation of RGS14 from the cytoplasm to the plasma membrane. May play a role in cell division (PubMed:17635935).
• PDB: 2IHB, 2ODE, 2V4Z, 4G5O, 4G5R, 4G5S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00503	G-alpha	13 → 343	G-protein alpha subunit	Domain

• Sequence:

  MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
  YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
  PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
  TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
  NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
  AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY

• Sequence length: 354