GNAI2 (G protein subunit alpha i2)

Gene

• Entrez ID: 2771
• Gene name: G protein subunit alpha i2
• Gene symbol: GNAI2
• Synonyms: GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs137853226	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs137853227	G>A	Pathogenic	Missense variant, coding sequence variant
rs137853228	T>A	Pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003274	hsa-miR-30d-5p	Western blot, Reporter assay;Other	20054866
MIRT003274	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT003274	hsa-miR-30d-5p	PAR-CLIP	26701625
MIRT005181	hsa-miR-30a-5p	pSILAC, Proteomics;Other	18668040
MIRT005181	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT005181	hsa-miR-30a-5p	PAR-CLIP	26701625
MIRT006020	hsa-miR-138-5p	Microarray, qRT-PCR, Western blot	21079996
MIRT022392	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT023620	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT036699	hsa-miR-935	CLASH	23622248
MIRT036851	hsa-miR-877-3p	CLASH	23622248
MIRT040616	hsa-miR-92b-3p	CLASH	23622248
MIRT043588	hsa-miR-148b-3p	CLASH	23622248
MIRT044144	hsa-miR-30e-5p	CLASH	23622248
MIRT044144	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT044144	hsa-miR-30e-5p	PAR-CLIP	26701625
MIRT162925	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT162925	hsa-miR-30c-5p	PAR-CLIP	26701625
MIRT162929	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT162930	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT162930	hsa-miR-30b-5p	PAR-CLIP	26701625
MIRT162999	hsa-miR-4328	HITS-CLIP	23824327
MIRT163073	hsa-miR-6516-5p	HITS-CLIP	23824327
MIRT390208	hsa-miR-583	PAR-CLIP	23592263
MIRT390208	hsa-miR-583	PAR-CLIP	20371350
MIRT390213	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT390213	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT390214	hsa-miR-4784	PAR-CLIP	23592263
MIRT390214	hsa-miR-4784	PAR-CLIP	20371350
MIRT489728	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT489728	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT489729	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT489729	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT489730	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT489730	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT489731	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT489731	hsa-miR-6787-5p	PAR-CLIP	20371350
MIRT489732	hsa-miR-6090	PAR-CLIP	23592263
MIRT489732	hsa-miR-6090	PAR-CLIP	20371350
MIRT489733	hsa-miR-663a	PAR-CLIP	23592263
MIRT489733	hsa-miR-663a	PAR-CLIP	20371350
MIRT489734	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT489734	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT489735	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT489735	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT489736	hsa-miR-4706	PAR-CLIP	23592263
MIRT489736	hsa-miR-4706	PAR-CLIP	20371350
MIRT489737	hsa-miR-8072	PAR-CLIP	23592263
MIRT489737	hsa-miR-8072	PAR-CLIP	20371350
MIRT489738	hsa-miR-3960	PAR-CLIP	23592263
MIRT489738	hsa-miR-3960	PAR-CLIP	20371350
MIRT489739	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT489739	hsa-miR-6889-5p	PAR-CLIP	20371350
MIRT489740	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT489740	hsa-miR-6777-5p	PAR-CLIP	20371350
MIRT489741	hsa-miR-3937	PAR-CLIP	23592263
MIRT489741	hsa-miR-3937	PAR-CLIP	20371350
MIRT616687	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT731902	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR	27811362
MIRT736309	hsa-miR-1237-5p	PAR-CLIP	26701625
MIRT739268	hsa-miR-2467-3p	PAR-CLIP	26701625
MIRT740034	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT740775	hsa-miR-3180-3p	PAR-CLIP	26701625
MIRT740815	hsa-miR-3180	PAR-CLIP	26701625
MIRT741072	hsa-miR-3196	PAR-CLIP	26701625
MIRT745231	hsa-miR-4488	PAR-CLIP	26701625
MIRT745963	hsa-miR-4530	PAR-CLIP	26701625
MIRT747235	hsa-miR-4697-5p	PAR-CLIP	26701625
MIRT755325	hsa-miR-6772-5p	PAR-CLIP	26701625
MIRT756801	hsa-miR-6816-5p	PAR-CLIP	26701625
MIRT758065	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT758110	hsa-miR-6875-5p	PAR-CLIP	26701625
MIRT760498	hsa-miR-922	PAR-CLIP	26701625
MIRT760667	hsa-miR-92b-5p	PAR-CLIP	26701625

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IBA	21873635
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IBA	21873635
GO:0003924	Function	GTPase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	16189514, 16782902, 18599439, 23773523, 25241761, 25416956, 32296183
GO:0005525	Function	GTP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	17635935
GO:0005813	Component	Centrosome	IDA	17635935
GO:0005829	Component	Cytosol	IDA
GO:0005834	Component	Heterotrimeric G-protein complex	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	17635935
GO:0005886	Component	Plasma membrane	TAS
GO:0006457	Process	Protein folding	TAS
GO:0007049	Process	Cell cycle	IEA
GO:0007165	Process	Signal transduction	TAS	7961880, 9637720
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS
GO:0007194	Process	Negative regulation of adenylate cyclase activity	TAS	9637720
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	IEA
GO:0007214	Process	Gamma-aminobutyric acid signaling pathway	IBA	21873635
GO:0007584	Process	Response to nutrient	TAS	8587610
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	21079996
GO:0016020	Component	Membrane	HDA	19946888
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030496	Component	Midbody	IDA	17635935
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IBA	21873635
GO:0032930	Process	Positive regulation of superoxide anion generation	IEA
GO:0033864	Process	Positive regulation of NAD(P)H oxidase activity	IEA
GO:0035810	Process	Positive regulation of urine volume	IEA
GO:0035815	Process	Positive regulation of renal sodium excretion	IEA
GO:0044297	Component	Cell body	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045202	Component	Synapse	IEA
GO:0045955	Process	Negative regulation of calcium ion-dependent exocytosis	IEA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050805	Process	Negative regulation of synaptic transmission	IEA
GO:0051301	Process	Cell division	IMP	17635935
GO:0051924	Process	Regulation of calcium ion transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	12519789, 19056867, 19199708, 20458337
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0140199	Process	Negative regulation of adenylate cyclase-activating adrenergic receptor signaling pathway involved in heart process	IEA
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:1903614	Process	Negative regulation of protein tyrosine phosphatase activity	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	IEA
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 139360
• HGNC: 4385
• e!Ensembl: ENSG00000114353

Protein

• UniProt ID: P04899
• Protein name: Guanine nucleotide-binding protein G(i) subunit alpha-2 (Adenylate cyclase-inhibiting G alpha protein)
• Protein function: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli. May play a role in cell division. ; [Isoform sGi2]: Regulates the cell surface density of dopamine receptors DRD2 by sequestrating them as an intracellular pool.
• PDB: 6D9H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00503	G-alpha	13 → 344	G-protein alpha subunit	Domain

• Sequence:

  MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
  YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
  PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
  KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
  MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
  ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF

• Sequence length: 355