GNAI1 (G protein subunit alpha i1)

Gene

• Entrez ID: 2770
• Gene name: G protein subunit alpha i1
• Gene symbol: GNAI1
• Synonyms: Gi
• Chromosome: 7
• Chromosome location: 7q21.11
• Summary: Guanine nucleotide binding proteins are heterotrimeric signal-transducing molecules consisting of alpha, beta, and gamma subunits. The alpha subunit binds guanine nucleotide, can hydrolyze GTP, and can interact with other proteins. The protein encoded by this gene represents the alpha subunit of an inhibitory complex. The encoded protein is part of a complex that responds to beta-adrenergic signals by inhibiting adenylate cyclase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021108	hsa-miR-186-5p	Sequencing	20371350
MIRT023552	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT054488	hsa-miR-320a	Luciferase reporter assay, Western blot, Immunohistochemical (IHC) staining	23691483
MIRT054489	hsa-miR-320c	Luciferase reporter assay, Western blot, Immunohistochemical (IHC) staining	23691483
MIRT054490	hsa-miR-320d	Luciferase reporter assay, Western blot, Immunohistochemical (IHC) staining	23691483
MIRT054491	hsa-miR-9-3p	Luciferase reporter assay, Western blot, Immunohistochemical (IHC) staining	23691483
MIRT610891	hsa-miR-4719	HITS-CLIP	23824327
MIRT610891	hsa-miR-4719	HITS-CLIP	23313552
MIRT610891	hsa-miR-4719	HITS-CLIP	27418678
MIRT610892	hsa-miR-8485	HITS-CLIP	23824327
MIRT610892	hsa-miR-8485	HITS-CLIP	23313552
MIRT610892	hsa-miR-8485	HITS-CLIP	27418678
MIRT619597	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT619597	hsa-miR-676-5p	HITS-CLIP	23313552
MIRT626101	hsa-miR-466	HITS-CLIP	23824327
MIRT626101	hsa-miR-466	HITS-CLIP	23313552
MIRT626101	hsa-miR-466	HITS-CLIP	27418678
MIRT626102	hsa-miR-4672	HITS-CLIP	23824327
MIRT626102	hsa-miR-4672	HITS-CLIP	23313552
MIRT626102	hsa-miR-4672	HITS-CLIP	27418678
MIRT626103	hsa-miR-3941	HITS-CLIP	23824327
MIRT626103	hsa-miR-3941	HITS-CLIP	23313552
MIRT626103	hsa-miR-3941	HITS-CLIP	27418678
MIRT626104	hsa-miR-603	HITS-CLIP	23824327
MIRT626104	hsa-miR-603	HITS-CLIP	23313552
MIRT626104	hsa-miR-603	HITS-CLIP	27418678
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT626105	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT626105	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT626106	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT626106	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT671961	hsa-miR-409-5p	HITS-CLIP	23824327
MIRT671961	hsa-miR-409-5p	HITS-CLIP	23313552
MIRT671961	hsa-miR-409-5p	HITS-CLIP	27418678

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	ISS
GO:0001664	Function	G protein-coupled receptor binding	IBA	21873635
GO:0001664	Function	G protein-coupled receptor binding	ISS
GO:0003924	Function	GTPase activity	IBA	21873635
GO:0003924	Function	GTPase activity	ISS
GO:0003924	Function	GTPase activity	TAS
GO:0005515	Function	Protein binding	IPI	15537540, 18434541, 22952234, 25416956, 28734930, 32296183
GO:0005525	Function	GTP binding	ISS
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	17635935
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005813	Component	Centrosome	IDA	17635935
GO:0005834	Component	Heterotrimeric G-protein complex	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	17635935, 23027904, 26766442
GO:0005886	Component	Plasma membrane	TAS
GO:0006457	Process	Protein folding	TAS
GO:0007049	Process	Cell cycle	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS
GO:0019003	Function	GDP binding	ISS
GO:0030496	Component	Midbody	IDA	17635935
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IBA	21873635
GO:0031821	Function	G protein-coupled serotonin receptor binding	IBA	21873635
GO:0032794	Function	GTPase activating protein binding	IEA
GO:0043434	Process	Response to peptide hormone	ISS
GO:0043949	Process	Regulation of cAMP-mediated signaling	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0050805	Process	Negative regulation of synaptic transmission	IEA
GO:0051301	Process	Cell division	IMP	17635935
GO:0060236	Process	Regulation of mitotic spindle organization	IMP	23027904
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0099738	Component	Cell cortex region	IDA	22327364, 23870127
GO:1904322	Process	Cellular response to forskolin	ISS
GO:1904778	Process	Positive regulation of protein localization to cell cortex	IMP	22327364, 23027904, 26766442

Other IDs

• MIM: 139310
• HGNC: 4384
• e!Ensembl: ENSG00000127955

Protein

• UniProt ID: P63096
• Protein name: Guanine nucleotide-binding protein G(i) subunit alpha-1 (Adenylate cyclase-inhibiting G alpha protein)
• Protein function: Guanine nucleotide-binding proteins (G proteins) function as transducers downstream of G protein-coupled receptors (GPCRs) in numerous signaling cascades. The alpha chain contains the guanine nucleotide binding site and alternates between an active, GTP-bound state and an inactive, GDP-bound state. Signaling by an activated GPCR promotes GDP release and GTP binding. The alpha subunit has a low GTPase activity that converts bound GTP to GDP, thereby terminating the signal. Both GDP release and GTP hydrolysis are modulated by numerous regulatory proteins (PubMed:8774883, PubMed:18434541). Signaling is mediated via effector proteins, such as adenylate cyclase. Inhibits adenylate cyclase activity, leading to decreased intracellular cAMP levels (By similarity). The inactive GDP-bound form prevents the association of RGS14 with centrosomes and is required for the translocation of RGS14 from the cytoplasm to the plasma membrane. Required for normal cytokinesis during mitosis (PubMed:17635935). Required for cortical dynein-dynactin complex recruitment during metaphase (PubMed:22327364).
• PDB: 1KJY, 1Y3A, 2G83, 2GTP, 2IK8, 2OM2, 2XNS, 3ONW, 3QE0, 3QI2, 3UMR, 3UMS, 4G5Q, 5JS7, 5JS8, 5TDH, 6CMO, 6CRK, 6DDE, 6DDF, 6KPF, 6KPG, 6LFM, 6LFO, 6LML, 6N4B, 6OMM, 6OS9, 6OSA, 6OT0, 6PB0, 6PB1, 6PT0, 6QNO, 6VU8, 6XBJ, 6XBK, 6XBL, 6XBM, 7JVR, 7L0P, 7L0Q, 7L0R, 7L0S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00503	G-alpha	13 → 343	G-protein alpha subunit	Domain

• Sequence:

  MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
  YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
  AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
  TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
  NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
  AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF

• Sequence length: 354