FXYD2 (FXYD domain containing ion transport regulator 2)

Gene

• Entrez ID: 486
• Gene name: FXYD domain containing ion transport regulator 2
• Gene symbol: FXYD2
• Synonyms: ATP1G1, HOMG2
• Chromosome: 11
• Chromosome location: 11q23.3
• Summary: This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019415	hsa-miR-148b-3p	Microarray	17612493
MIRT022024	hsa-miR-128-3p	Microarray	17612493
MIRT444230	hsa-miR-4999-5p	PAR-CLIP	22100165
MIRT444231	hsa-miR-27b-5p	PAR-CLIP	22100165
MIRT444232	hsa-miR-4742-3p	PAR-CLIP	22100165
MIRT444233	hsa-miR-4538	PAR-CLIP	22100165
MIRT444234	hsa-miR-4453	PAR-CLIP	22100165
MIRT444235	hsa-miR-941	PAR-CLIP	22100165

Transcription factors

Transcription factor	Regulation	Reference
HNF1B	Unknown	24204001
PCBD1	Repression	24204001

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001671	Function	ATPase activator activity	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	ISS
GO:0017080	Function	Sodium channel regulator activity	IBA	21873635
GO:0030674	Function	Protein-macromolecule adaptor activity	ISS
GO:0032781	Process	Positive regulation of ATPase activity	IEA
GO:0034220	Process	Ion transmembrane transport	TAS
GO:0036376	Process	Sodium ion export across plasma membrane	ISS
GO:0055085	Process	Transmembrane transport	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0099106	Function	Ion channel regulator activity	IEA
GO:1903408	Process	Positive regulation of sodium:potassium-exchanging ATPase activity	ISS
GO:1903779	Process	Regulation of cardiac conduction	TAS
GO:1990573	Process	Potassium ion import across plasma membrane	ISS
GO:2000649	Process	Regulation of sodium ion transmembrane transporter activity	IBA	21873635

Other IDs

• MIM: 601814
• HGNC: 4026
• e!Ensembl: ENSG00000137731

Protein

• UniProt ID: P54710
• Protein name: Sodium/potassium-transporting ATPase subunit gamma (Na(+)/K(+) ATPase subunit gamma) (FXYD domain-containing ion transport regulator 2) (Sodium pump gamma chain)
• Protein function: May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.
• PDB: 2MKV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02038	ATP1G1_PLM_MAT8	14 → 60	ATP1G1/PLM/MAT8 family	Family

• Sequence:

  MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQ
  INEDEP

• Sequence length: 66