FUT2 (fucosyltransferase 2)

Gene

• Entrez ID: 2524
• Gene name: Fucosyltransferase 2
• Gene symbol: FUT2
• Synonyms: B12QTL1, SE, SEC2, Se2, sej
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437485	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24122375
MIRT662028	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT662029	hsa-miR-640	HITS-CLIP	23824327
MIRT662030	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT662031	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT662032	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT662033	hsa-miR-3176	HITS-CLIP	23824327
MIRT662034	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT662035	hsa-miR-8079	HITS-CLIP	23824327
MIRT662036	hsa-miR-1245a	HITS-CLIP	23824327
MIRT662037	hsa-miR-504-5p	HITS-CLIP	23824327
MIRT674197	hsa-miR-665	HITS-CLIP	23824327
MIRT674198	hsa-miR-6771-5p	HITS-CLIP	23824327
MIRT674199	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT674200	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT674201	hsa-miR-1827	HITS-CLIP	23824327
MIRT674202	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT674203	hsa-miR-6746-5p	HITS-CLIP	23824327
MIRT674204	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT674205	hsa-miR-4478	HITS-CLIP	23824327
MIRT674206	hsa-miR-4419b	HITS-CLIP	23824327
MIRT674207	hsa-miR-3929	HITS-CLIP	23824327
MIRT674208	hsa-miR-940	HITS-CLIP	23824327
MIRT674209	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT674210	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT674211	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT690878	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT690879	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT690880	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT690881	hsa-miR-3122	HITS-CLIP	23313552
MIRT690882	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT690883	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT690884	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT690885	hsa-miR-3689c	HITS-CLIP	23313552
MIRT690886	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT690887	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT690888	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT690889	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT690890	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT690891	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT690892	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT690893	hsa-miR-7977	HITS-CLIP	23313552
MIRT690894	hsa-miR-5693	HITS-CLIP	23313552
MIRT690895	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT690896	hsa-miR-3591-3p	HITS-CLIP	23313552
MIRT690897	hsa-miR-21-3p	HITS-CLIP	23313552

Transcription factors

Transcription factor	Regulation	Reference
CDX2	Activation	22547830

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001936	Process	Regulation of endothelial cell proliferation	ISS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005794	Component	Golgi apparatus	TAS	11698403
GO:0005975	Process	Carbohydrate metabolic process	TAS	7876235
GO:0006486	Process	Protein glycosylation	IBA	21873635
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	TAS	11698403
GO:0006664	Process	Glycolipid metabolic process	ISS
GO:0008107	Function	Galactoside 2-alpha-L-fucosyltransferase activity	IBA	21873635
GO:0008107	Function	Galactoside 2-alpha-L-fucosyltransferase activity	TAS	11698403
GO:0008417	Function	Fucosyltransferase activity	TAS	7876235
GO:0016021	Component	Integral component of membrane	IEA
GO:0030155	Process	Regulation of cell adhesion	ISS
GO:0031127	Function	Alpha-(1,2)-fucosyltransferase activity	ISS
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0036065	Process	Fucosylation	IBA	21873635
GO:0036065	Process	Fucosylation	ISS
GO:0042355	Process	L-fucose catabolic process	NAS	11698403
GO:0070062	Component	Extracellular exosome	HDA	19199708

Other IDs

• MIM: 182100
• HGNC: 4013
• e!Ensembl: ENSG00000176920

Protein

• UniProt ID: Q10981
• Protein name: Galactoside alpha-(1,2)-fucosyltransferase 2 (Alpha(1,2)FT 2) (Fucosyltransferase 2) (GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2) (SE2) (Secretor blood group alpha-2-fucosyltransferase) (Secretor factor) (Se) (Type 1 galactoside alpha-(1,2)-fucosyltransferase FUT2) (EC 2.4.1.69) (Type 2 galactoside alpha-(1,2)-fucosyltransferase FUT2) (EC 2.4.1.344)
• Protein function: Catalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to the terminal galactose on both O- and N-linked glycans chains of cell surface glycoproteins and glycolipids and the resulting epitope regulates several processes such as cell-cell interaction including host-microbe interaction, cell surface expression and cell proliferation (PubMed:7876235, PubMed:8018146, PubMed:12692541). Preferentially fucosylates gangliosides GA1 and GM1 in the antrum, cecum and colon and in the female reproductive organs (By similarity). Fucosylated host glycoproteins or glycolipids mediate interaction with intestinal microbiota influencing its composition (PubMed:22068912, PubMed:21625510, PubMed:24733310). Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble ABO blood group antigen synthesis pathway (PubMed:7876235).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01531	Glyco_transf_11	21 → 334	Glycosyl transferase family 11	Family

• Sequence:

  MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQL
  RGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATAS
  RIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQK
  FLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFV
  VTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTG
  GDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH

• Sequence length: 343