FER (FER tyrosine kinase)

Gene

• Entrez ID: 2241
• Gene name: FER tyrosine kinase
• Gene symbol: FER
• Synonyms: PPP1R74, TYK3, p94-Fer
• Chromosome: 5
• Chromosome location: 5q21.3
• Summary: The protein encoded by this gene is a member of the FPS/FES family of non-transmembrane receptor tyrosine kinases. It regulates cell-cell adhesion and mediates signaling from the cell surface to the cytoskeleton via growth factor receptors. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome X. [provided by RefSeq, Apr 2015]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT038279	hsa-miR-26a-2-3p	CLASH	23622248
MIRT050063	hsa-miR-26a-5p	CLASH	23622248
MIRT051027	hsa-miR-17-5p	CLASH	23622248
MIRT447431	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT447432	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT447433	hsa-miR-4635	PAR-CLIP	22100165
MIRT447434	hsa-miR-5011-5p	PAR-CLIP	22100165
MIRT447435	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT447436	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT626648	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT626649	hsa-miR-557	HITS-CLIP	23824327
MIRT626650	hsa-miR-507	HITS-CLIP	23824327
MIRT626651	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT626652	hsa-miR-218-1-3p	HITS-CLIP	23824327
MIRT626653	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT626654	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT626655	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT626656	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT626657	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT626658	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT626659	hsa-miR-4326	HITS-CLIP	23824327
MIRT626660	hsa-miR-4469	HITS-CLIP	23824327
MIRT626661	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT626662	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT626663	hsa-miR-582-3p	HITS-CLIP	23824327
MIRT648985	hsa-miR-6071	HITS-CLIP	23824327
MIRT648986	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT648987	hsa-miR-3692-5p	HITS-CLIP	23824327
MIRT648988	hsa-miR-93-3p	HITS-CLIP	23824327
MIRT648989	hsa-miR-4686	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IMP	12972546
GO:0000785	Component	Chromatin	IDA	1990274
GO:0001932	Process	Regulation of protein phosphorylation	ISS
GO:0004713	Function	Protein tyrosine kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	TAS	2725517
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA	21873635
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	12972546, 19738202
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005154	Function	Epidermal growth factor receptor binding	IDA	21518868
GO:0005515	Function	Protein binding	IPI	15226396, 25036637
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	19147545
GO:0005737	Component	Cytoplasm	IDA	1990274
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005938	Component	Cell cortex	IEA
GO:0006468	Process	Protein phosphorylation	TAS	2725517
GO:0006935	Process	Chemotaxis	IBA	21873635
GO:0007155	Process	Cell adhesion	IBA	21873635
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007260	Process	Tyrosine phosphorylation of STAT protein	IDA	19147545
GO:0008157	Function	Protein phosphatase 1 binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	25540073
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	20111072
GO:0008289	Function	Lipid binding	IDA	19738202
GO:0010591	Process	Regulation of lamellipodium assembly	IDA	19738202
GO:0010762	Process	Regulation of fibroblast migration	IEA
GO:0015629	Component	Actin cytoskeleton	IDA	19738202
GO:0015630	Component	Microtubule cytoskeleton	IDA	12972546
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	12972546, 19738202
GO:0019221	Process	Cytokine-mediated signaling pathway	IMP	9722593
GO:0030027	Component	Lamellipodium	IDA	19738202
GO:0030054	Component	Cell junction	IDA	12972546
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030335	Process	Positive regulation of cell migration	IMP	19738202
GO:0030838	Process	Positive regulation of actin filament polymerization	IMP	19738202
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IBA	21873635
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IDA	19738202
GO:0031532	Process	Actin cytoskeleton reorganization	ISS
GO:0032496	Process	Response to lipopolysaccharide	ISS
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0033007	Process	Negative regulation of mast cell activation involved in immune response	ISS
GO:0034446	Process	Substrate adhesion-dependent cell spreading	ISS
GO:0034614	Process	Cellular response to reactive oxygen species	ISS
GO:0035426	Process	Extracellular matrix-cell signaling	ISS
GO:0035556	Process	Intracellular signal transduction	TAS	2209086
GO:0036006	Process	Cellular response to macrophage colony-stimulating factor stimulus	IMP	9722593
GO:0036119	Process	Response to platelet-derived growth factor	ISS
GO:0038028	Process	Insulin receptor signaling pathway via phosphatidylinositol 3-kinase	ISS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IBA	21873635
GO:0038095	Process	Fc-epsilon receptor signaling pathway	ISS
GO:0038109	Process	Kit signaling pathway	ISS
GO:0042058	Process	Regulation of epidermal growth factor receptor signaling pathway	IMP	21518868
GO:0043304	Process	Regulation of mast cell degranulation	IBA	21873635
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	ISS
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0046777	Process	Protein autophosphorylation	IDA	7623846
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	ISS
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	TAS	11994747
GO:0050904	Process	Diapedesis	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	21518868
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IMP	19147545

Other IDs

• MIM: 176942
• HGNC: 3655
• e!Ensembl: ENSG00000151422

Protein

• UniProt ID: P16591
• Protein name: Tyrosine-protein kinase Fer (EC 2.7.10.2) (Feline encephalitis virus-related kinase FER) (Fujinami poultry sarcoma/Feline sarcoma-related protein Fer) (Proto-oncogene c-Fer) (Tyrosine kinase 3) (p94-Fer)
• Protein function: Tyrosine-protein kinase that acts downstream of cell surface receptors for growth factors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, lamellipodia formation, cell adhesion, cell migration and chemotaxis. Acts downstream of EGFR, KIT, PDGFRA and PDGFRB. Acts downstream of EGFR to promote activation of NF-kappa-B and cell proliferation. May play a role in the regulation of the mitotic cell cycle. Plays a role in the insulin receptor signaling pathway and in activation of phosphatidylinositol 3-kinase. Acts downstream of the activated FCER1 receptor and plays a role in FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Plays a role in the regulation of mast cell degranulation. Plays a role in leukocyte recruitment and diapedesis in response to bacterial lipopolysaccharide (LPS). Plays a role in synapse organization, trafficking of synaptic vesicles, the generation of excitatory postsynaptic currents and neuron-neuron synaptic transmission. Plays a role in neuronal cell death after brain damage. Phosphorylates CTTN, CTNND1, PTK2/FAK1, GAB1, PECAM1 and PTPN11. May phosphorylate JUP and PTPN1. Can phosphorylate STAT3, but the biological relevance of this depends on cell type and stimulus.
• PDB: 2KK6, 6KC4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00611	FCH	10 → 87	Fes/CIP4, and EFC/F-BAR homology domain	Family
  PF00017	SH2	460 → 531	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	563 → 814	Protein tyrosine and serine/threonine kinase	Domain

• Sequence:

  MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQ
  MNYVSNVSKSWLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQ
  IEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHM
  LHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEI
  VNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNL
  TAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQAL
  EELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSK
  FESIRHSIAGIIRSPKSALGSSALSDMISISEKPLAEQDWYHGAIPRIEAQELLKKQGDF
  LVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITK
  KSGVVLLNPIPKDKKWILSHEDVILGELLGKGNFGEVYKGTLKDKTSVAVKTCKEDLPQE
  LKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPVYIIMELVSGGDFLTFLRRKKDELKLKQ
  LVKFSLDAAAGMLYLESKNCIHRDLAARNCLVGENNVLKISDFGMSRQEDGGVYSSSGLK
  QIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRMS
  APQHCPEDISKIMMKCWDYKPENRPKFSELQKELTIIKRKLT

• Sequence length: 822