FCGR1A (Fc fragment of IgG receptor Ia)

Gene

• Entrez ID: 2209
• Gene name: Fc fragment of IgG receptor Ia
• Gene symbol: FCGR1A
• Synonyms: CD64, CD64A, FCRI, IGFR1
• Chromosome: 1
• Chromosome location: 1q21.2
• Summary: This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1. [provided by RefSeq, Jul 2008]

Transcription factors

Transcription factor	Regulation	Reference
SPI1	Unknown	10820245;14734612
STAT1	Unknown	14734612

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004888	Function	Transmembrane signaling receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	18322202, 22003208, 25925696, 29143175, 32296183
GO:0005886	Component	Plasma membrane	IDA	18322202
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006898	Process	Receptor-mediated endocytosis	TAS
GO:0006911	Process	Phagocytosis, engulfment	TAS	10879688
GO:0006955	Process	Immune response	TAS	10879688
GO:0007165	Process	Signal transduction	TAS	10879688
GO:0007166	Process	Cell surface receptor signaling pathway	IBA	21873635
GO:0019864	Function	IgG binding	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031901	Component	Early endosome membrane	TAS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0050776	Process	Regulation of immune response	IBA	21873635
GO:0050776	Process	Regulation of immune response	TAS
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0061098	Process	Positive regulation of protein tyrosine kinase activity	IMP	10556798

Other IDs

• MIM: 146760
• HGNC: 3613
• e!Ensembl: ENSG00000150337

Protein

• UniProt ID: P12314
• Protein name: High affinity immunoglobulin gamma Fc receptor I (IgG Fc receptor I) (Fc-gamma RI) (FcRI) (Fc-gamma RIA) (FcgammaRIa) (CD antigen CD64)
• Protein function: High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
• PDB: 3RJD, 4W4O, 4X4M, 4ZNE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13927	Ig_3	23 → 87		Domain
  PF13895	Ig_2	104 → 185	Immunoglobulin domain	Domain
  PF00047	ig	195 → 275	Immunoglobulin domain	Domain

• Sequence:

  MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
  TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPL
  ALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
  ISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRN
  TSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFYLAVG
  IMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQ
  LQEGVHRKEPQGAT

• Sequence length: 374