GediPNet logo

FAS (Fas cell surface death receptor)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
355
Gene nameGene Name - the full gene name approved by the HGNC.
Fas cell surface death receptor
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
FAS
SynonymsGene synonyms aliases
ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
ChromosomeChromosome number
10
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q23.31
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. Several alternatively spliced transcript variants have been described, some of which are candidates for nonsense-mediated mRNA decay (NMD). The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform. [provided by RefSeq, Mar 2011]
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28929498 A>T Pathogenic Missense variant, coding sequence variant, 3 prime UTR variant, non coding transcript variant
rs56006128 G>A Conflicting-interpretations-of-pathogenicity, uncertain-significance, not-provided Intron variant, coding sequence variant, missense variant, non coding transcript variant
rs121913076 A>C Pathogenic Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913077 C>T Pathogenic Non coding transcript variant, stop gained, 3 prime UTR variant, coding sequence variant
rs121913078 C>T Pathogenic Intron variant, missense variant, non coding transcript variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002421 hsa-miR-21-5p Microarray 20048743
MIRT005581 hsa-miR-146a-5p Luciferase reporter assay, Western blot 20656888
MIRT005581 hsa-miR-146a-5p Luciferase reporter assay 23645835
MIRT006331 hsa-miR-106a-5p Luciferase reporter assay 22431000
MIRT006331 hsa-miR-106a-5p Flow, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot 27142596
Transcription factors
Transcription factor Regulation Reference
ATF2 Unknown 19670268
ATM Activation 19502594
EGR1 Repression 9300687
FOS Activation 10903433
GLI1 Repression 21135115
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001934 Process Positive regulation of protein phosphorylation IMP 11096076
GO:0005031 Function Tumor necrosis factor-activated receptor activity IBA 21873635
GO:0005515 Function Protein binding IPI 7536190, 7538907, 10918185, 11003656, 11495919, 11606059, 12724420, 12887920, 15465831, 16498403, 17047155, 17159907, 18328427, 18846110, 21109225, 21382479, 21625644, 21803845, 25241761
GO:0005516 Function Calmodulin binding IDA 24914971
GO:0005829 Component Cytosol IDA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P25445
Protein name Tumor necrosis factor receptor superfamily member 6 (Apo-1 antigen) (Apoptosis-mediating surface antigen FAS) (FASLG receptor) (CD antigen CD95)
Protein function Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro).
PDB 1BZI , 1DDF , 2NA7 , 3EWT , 3EZQ , 3THM , 3TJE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6
85 127
TNFR/NGFR cysteine-rich region
Domain
PF00020 TNFR_c6
129 165
TNFR/NGFR cysteine-rich region
Domain
PF00531 Death
230 314
Death domain
Domain
Sequence
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKC
RCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL
LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM
TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK
ANLCTLAEKIQTII
LKDITSDSENSNFRNEIQSLV
Sequence length 335
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412