FABP1 (fatty acid binding protein 1)

Gene

• Entrez ID: 2168
• Gene name: Fatty acid binding protein 1
• Gene symbol: FABP1
• Synonyms: FABPL, L-FABP
• Chromosome: 2
• Chromosome location: 2p11.2
• Summary: This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018987	hsa-miR-335-5p	Microarray	18185580

Transcription factors

Transcription factor	Regulation	Reference
HNF1A	Unknown	20357450

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003682	Function	Chromatin binding	IEA
GO:0005324	Function	Long-chain fatty acid transporter activity	IEA
GO:0005504	Function	Fatty acid binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005543	Function	Phospholipid binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005782	Component	Peroxisomal matrix	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0008144	Function	Drug binding	IEA
GO:0015909	Process	Long-chain fatty acid transport	IEA
GO:0016209	Function	Antioxidant activity	IDA	16175609
GO:0019216	Process	Regulation of lipid metabolic process	TAS
GO:0019433	Process	Triglyceride catabolic process	TAS
GO:0032000	Process	Positive regulation of fatty acid beta-oxidation	IEA
GO:0032052	Function	Bile acid binding	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	16175609
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	16175609
GO:0045179	Component	Apical cortex	IEA
GO:0050892	Process	Intestinal absorption	IEA
GO:0051345	Process	Positive regulation of hydrolase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	16175609
GO:0071456	Process	Cellular response to hypoxia	IDA	16175609
GO:0098869	Process	Cellular oxidant detoxification	IEA

Other IDs

• MIM: 134650
• HGNC: 3555
• e!Ensembl: ENSG00000163586

Protein

• UniProt ID: P07148
• Protein name: Fatty acid-binding protein, liver (Fatty acid-binding protein 1) (Liver-type fatty acid-binding protein) (L-FABP)
• Protein function: Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PubMed:25732850). Binds cholesterol (PubMed:25732850). Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport (By similarity).
• PDB: 2F73, 2L67, 2L68, 2LKK, 2PY1, 3B2H, 3B2I, 3B2J, 3B2K, 3B2L, 3STK, 3STM, 3STN, 3VG2, 3VG3, 3VG4, 3VG5, 3VG6, 3VG7, 6DO6, 6DO7, 6DRG, 6MP4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14651	Lipocalin_7	1 → 127		Domain

• Sequence:

  MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
  NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
  KRISKRI

• Sequence length: 127