EP300 (E1A binding protein p300)

Gene

• Entrez ID: 2033
• Gene name: E1A binding protein p300
• Gene symbol: EP300
• Synonyms: KAT3B, MKHK2, RSTS2, p300
• Chromosome: 22
• Chromosome location: 22q13.2
• Summary: This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer. [provided by RefSeq, Jul 2008]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs28937578	C>A,T	Pathogenic	Coding sequence variant, missense variant
rs137853038	C>T	Pathogenic	Coding sequence variant, stop gained
rs137853039	C>T	Pathogenic	Coding sequence variant, stop gained
rs139310551	C>A,T	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs147583157	A>G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs150498069	C>G,T	Conflicting-interpretations-of-pathogenicity, benign, likely-benign	Coding sequence variant, synonymous variant
rs368437789	C>T	Conflicting-interpretations-of-pathogenicity	Intron variant
rs528866215	C>T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs533875300	GCA>-	Pathogenic, likely-benign, benign-likely-benign	Inframe deletion, coding sequence variant
rs565779970	T>A,C	Pathogenic, likely-pathogenic	Synonymous variant, coding sequence variant, stop gained
rs587778256	CCAGTTCCAGCA>-	Pathogenic, likely-benign	Coding sequence variant, inframe indel
rs746398873	G>A,T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs786205557	C>A	Likely-pathogenic	Coding sequence variant, stop gained
rs797045559	->T	Pathogenic	Frameshift variant, coding sequence variant
rs797045560	TCAA>-	Pathogenic	Frameshift variant, coding sequence variant
rs875989807	CAGCAGCAACAG>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs876661318	TATACTCAGAATCCTGGA>-	Pathogenic	Inframe deletion, coding sequence variant
rs879253873	->C	Pathogenic	Frameshift variant, coding sequence variant
rs886037664	CTCT>-	Pathogenic	Frameshift variant, coding sequence variant
rs886041520	G>T	Pathogenic	Splice acceptor variant
rs886041739	C>G,T	Pathogenic	Missense variant, coding sequence variant, stop gained
rs886041830	C>T	Pathogenic	Coding sequence variant, stop gained
rs886042977	GTAA>-	Likely-pathogenic	Splice donor variant, intron variant
rs886043598	C>A,T	Pathogenic	Synonymous variant, coding sequence variant, stop gained
rs1057517732	T>G	Uncertain-significance, pathogenic, not-provided	Coding sequence variant, missense variant
rs1057518002	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519012	->G	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1057519375	CA>-	Pathogenic	Frameshift variant, coding sequence variant
rs1057519889	G>A,T	Likely-pathogenic	Coding sequence variant, missense variant
rs1057521737	T>C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1064794624	->CCTATGTATATCTCCTATACATATCTCCTATCGAACA	Pathogenic	Frameshift variant, coding sequence variant
rs1064795607	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1064797038	C>T	Pathogenic	Coding sequence variant, stop gained
rs1085307564	ACCAACTG>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1085307911	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1114167305	G>C	Pathogenic	Intron variant
rs1114167306	T>G	Pathogenic	Coding sequence variant, missense variant
rs1210404526	C>G,T	Likely-pathogenic	Missense variant, coding sequence variant
rs1464734494	G>A,C	Likely-pathogenic	Synonymous variant, coding sequence variant, missense variant
rs1555902247	TC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555905780	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555907278	C>T	Pathogenic	Coding sequence variant, stop gained
rs1555907286	C>A	Likely-pathogenic	Coding sequence variant, stop gained
rs1555907749	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1555909666	G>T	Pathogenic	Coding sequence variant, stop gained
rs1555909697	AAAGA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555910114	A>G	Pathogenic	Splice acceptor variant
rs1555910122	->G	Pathogenic	Coding sequence variant, frameshift variant
rs1555910482	AGAA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555910602	TTG>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs1555910814	C>T	Pathogenic	Coding sequence variant, stop gained
rs1555910821	A>G	Pathogenic-likely-pathogenic	Missense variant, coding sequence variant
rs1555911075	C>T	Pathogenic	Coding sequence variant, stop gained
rs1555911098	A>G	Likely-pathogenic	Splice acceptor variant
rs1555911201	->AC	Pathogenic	Coding sequence variant, frameshift variant
rs1555911313	C>G,T	Pathogenic, not-provided	Missense variant, coding sequence variant, stop gained
rs1555911316	ACCCAA>-	Likely-pathogenic	Inframe indel, coding sequence variant
rs1555911334	G>T	Likely-pathogenic	Intron variant
rs1555911573	C>T	Uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs1555911580	AGAAAACGAGA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555912040	->ATGT	Pathogenic	Coding sequence variant, frameshift variant
rs1555912107	T>C,G	Likely-pathogenic	Missense variant, coding sequence variant
rs1555912238	C>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1555912362	C>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1569090642	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1569107391	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1569108381	CACAGAAG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1569118537	C>T	Pathogenic	Coding sequence variant, stop gained
rs1569120903	A>C	Pathogenic	Missense variant, coding sequence variant
rs1569120910	GGA>-	Pathogenic	Inframe deletion, coding sequence variant
rs1569122847	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1601598122	C>T	Pathogenic	Coding sequence variant, stop gained
rs1601598354	TGAA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1601607265	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1601610306	GCCAT>TATGTTGAGCCATAACTGCATGTTGAGCCCA	Pathogenic	Inframe indel, coding sequence variant, stop gained
rs1601613391	C>T	Pathogenic	Coding sequence variant, stop gained
rs1601617062	->A	Likely-pathogenic	Intron variant, coding sequence variant, frameshift variant
rs1601617065	A>-	Pathogenic	Intron variant, coding sequence variant, frameshift variant
rs1601618876	TATGGGC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1601621480	AGAGA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1601621506	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1601623271	C>T	Pathogenic	Coding sequence variant, stop gained
rs1601624722	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1601624754	TG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1601624790	->A	Pathogenic	Coding sequence variant, stop gained
rs1601628237	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1601629319	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1601633128	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1601633708	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1601634247	C>T	Pathogenic	Coding sequence variant, stop gained
rs1601636935	->T	Likely-pathogenic	Coding sequence variant, stop gained
rs1601639958	G>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1601640102	GGCCAAC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1601640325	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1601640370	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1601641819	A>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1601642812	A>G	Pathogenic	Stop lost, terminator codon variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003598	hsa-miR-200c-3p	Microarray	19569050
MIRT003599	hsa-miR-200b-3p	Microarray	19569050
MIRT003600	hsa-miR-429	Microarray	19569050
MIRT003601	hsa-miR-182-5p	Microarray	19569050
MIRT003603	hsa-miR-194-5p	Microarray	19569050
MIRT003604	hsa-miR-26b-5p	Microarray	19569050
MIRT003604	hsa-miR-26b-5p	HITS-CLIP	27418678
MIRT004566	hsa-miR-374a-5p	Microarray	19569050
MIRT007087	hsa-miR-150-5p	Luciferase reporter assay	23211718
MIRT007087	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	27285761
MIRT021346	hsa-miR-9-5p	Microarray	17612493
MIRT038305	hsa-miR-130b-5p	CLASH	23622248
MIRT039708	hsa-miR-615-3p	CLASH	23622248
MIRT041181	hsa-miR-181d-5p	CLASH	23622248
MIRT041490	hsa-miR-193b-3p	CLASH	23622248
MIRT045469	hsa-miR-149-5p	CLASH	23622248
MIRT045823	hsa-miR-140-5p	CLASH	23622248
MIRT046334	hsa-miR-23b-3p	CLASH	23622248
MIRT047254	hsa-miR-181b-5p	CLASH	23622248
MIRT047948	hsa-miR-30c-5p	CLASH	23622248
MIRT049743	hsa-miR-92a-3p	CLASH	23622248
MIRT049923	hsa-miR-30a-3p	CLASH	23622248
MIRT050220	hsa-miR-25-3p	CLASH	23622248
MIRT051995	hsa-let-7b-5p	CLASH	23622248
MIRT054244	hsa-miR-574-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23554959
MIRT301684	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT301684	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT301685	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT301685	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT609030	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT609030	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT609031	hsa-miR-4433b-3p	HITS-CLIP	24906430
MIRT609031	hsa-miR-4433b-3p	HITS-CLIP	27418678
MIRT609032	hsa-miR-7109-5p	HITS-CLIP	24906430
MIRT609032	hsa-miR-7109-5p	HITS-CLIP	27418678
MIRT609033	hsa-miR-4758-5p	HITS-CLIP	24906430
MIRT609033	hsa-miR-4758-5p	HITS-CLIP	27418678
MIRT609034	hsa-miR-1238-5p	HITS-CLIP	24906430
MIRT609034	hsa-miR-1238-5p	HITS-CLIP	27418678
MIRT609035	hsa-miR-4472	HITS-CLIP	24906430
MIRT609035	hsa-miR-4472	HITS-CLIP	27418678
MIRT609036	hsa-miR-4447	HITS-CLIP	24906430
MIRT609036	hsa-miR-4447	HITS-CLIP	27418678
MIRT609037	hsa-miR-6885-5p	HITS-CLIP	24906430
MIRT609037	hsa-miR-6885-5p	HITS-CLIP	27418678
MIRT609038	hsa-miR-328-5p	HITS-CLIP	24906430
MIRT609038	hsa-miR-328-5p	HITS-CLIP	27418678
MIRT609039	hsa-miR-6887-5p	HITS-CLIP	24906430
MIRT609039	hsa-miR-6887-5p	HITS-CLIP	27418678
MIRT609040	hsa-miR-6795-5p	HITS-CLIP	24906430
MIRT609040	hsa-miR-6795-5p	HITS-CLIP	27418678
MIRT609041	hsa-miR-4481	HITS-CLIP	24906430
MIRT609041	hsa-miR-4481	HITS-CLIP	27418678
MIRT609042	hsa-miR-4745-5p	HITS-CLIP	24906430
MIRT609042	hsa-miR-4745-5p	HITS-CLIP	27418678
MIRT609043	hsa-miR-1296-3p	HITS-CLIP	24906430
MIRT609043	hsa-miR-1296-3p	HITS-CLIP	27418678
MIRT783480	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT783650	hsa-miR-1297	HITS-CLIP	27418678
MIRT783726	hsa-miR-1305	HITS-CLIP	27418678
MIRT784361	hsa-miR-26a-5p	HITS-CLIP	27418678
MIRT784736	hsa-miR-3173-3p	HITS-CLIP	27418678
MIRT785830	hsa-miR-4428	HITS-CLIP	27418678
MIRT785949	hsa-miR-4465	HITS-CLIP	27418678
MIRT786915	hsa-miR-498	HITS-CLIP	27418678
MIRT787634	hsa-miR-555	HITS-CLIP	27418678
MIRT787972	hsa-miR-595	HITS-CLIP	27418678
MIRT788574	hsa-miR-6755-5p	HITS-CLIP	27418678
MIRT789020	hsa-miR-6835-5p	HITS-CLIP	27418678
MIRT789041	hsa-miR-6841-5p	HITS-CLIP	27418678
MIRT789310	hsa-miR-6885-3p	HITS-CLIP	27418678
MIRT789353	hsa-miR-6891-5p	HITS-CLIP	27418678

Transcription factors

Transcription factor	Regulation	Reference
AR	Activation	22334658
BRCA1	Activation	11782371
BRCA1	Unknown	11405179
CREBBP	Unknown	15154850
EGR1	Activation	18798221;20414733
EGR1	Unknown	15635605
FLI1	Unknown	24058639
MYC	Unknown	12776737
NUPR1	Unknown	22858377
PML	Activation	18809579

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10733570
GO:0000123	Component	Histone acetyltransferase complex	IBA	21873635
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	23811396
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001085	Function	RNA polymerase II transcription factor binding	IBA	21873635
GO:0001102	Function	RNA polymerase II activating transcription factor binding	IPI	20018936, 23811396
GO:0001666	Process	Response to hypoxia	IDA	9887100, 15261140
GO:0001756	Process	Somitogenesis	IEA
GO:0001966	Process	Thigmotaxis	IEA
GO:0002039	Function	P53 binding	IEA
GO:0002209	Process	Behavioral defense response	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0003677	Function	DNA binding	IDA	9194565
GO:0003682	Function	Chromatin binding	IDA	24939902, 25818647
GO:0003682	Function	Chromatin binding	IMP	17641689
GO:0003684	Function	Damaged DNA binding	IDA	24939902
GO:0003713	Function	Transcription coactivator activity	IBA	21873635
GO:0003713	Function	Transcription coactivator activity	IDA	12435739, 12586840, 12929931, 16687403, 17641689, 18487222
GO:0003713	Function	Transcription coactivator activity	IMP	11940591
GO:0003713	Function	Transcription coactivator activity	IPI	23811396
GO:0003713	Function	Transcription coactivator activity	TAS	10362258
GO:0004402	Function	Histone acetyltransferase activity	IBA	21873635
GO:0004402	Function	Histone acetyltransferase activity	IDA	12040021, 14645221, 23415232, 25818647
GO:0004402	Function	Histone acetyltransferase activity	TAS	10362258
GO:0004468	Function	Lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IDA	20019387
GO:0005515	Function	Protein binding	IPI	1331501, 8684459, 9018065, 9194564, 9194565, 9811832, 9881977, 9887100, 10049825, 10330164, 10518217, 10702269, 10722728, 10866661, 11029584, 11073990, 11430825, 11581164, 11909954, 11940591, 11940655, 12368347, 12435739, 12527917, 12586840, 12743606, 12750254, 12929931, 14645221, 14
GO:0005634	Component	Nucleus	IDA	9194565, 12929931, 14645221
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA	21873635
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006110	Process	Regulation of glycolytic process	IDA	29775581
GO:0006283	Process	Transcription-coupled nucleotide-excision repair	TAS
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	15261140
GO:0006473	Process	Protein acetylation	IDA	21030595, 24939902
GO:0006473	Process	Protein acetylation	TAS	22013210
GO:0006475	Process	Internal protein amino acid acetylation	IDA	18722353
GO:0006915	Process	Apoptotic process	IMP	9194565
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS
GO:0006990	Process	Positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response	ISS
GO:0007219	Process	Notch signaling pathway	TAS
GO:0007221	Process	Positive regulation of transcription of Notch receptor target	TAS
GO:0007399	Process	Nervous system development	TAS	27256286
GO:0007507	Process	Heart development	IEA
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0007623	Process	Circadian rhythm	ISS
GO:0008013	Function	Beta-catenin binding	IPI	12408825
GO:0008022	Function	Protein C-terminus binding	IDA	17150957
GO:0008134	Function	Transcription factor binding	IPI	8684459, 11349124, 15261140, 26504087
GO:0008270	Function	Zinc ion binding	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0010506	Process	Regulation of autophagy	TAS	24852146
GO:0010742	Process	Macrophage derived foam cell differentiation	IDA	26504087
GO:0010821	Process	Regulation of mitochondrion organization	ISS
GO:0010976	Process	Positive regulation of neuron projection development	IDA	27256286
GO:0016032	Process	Viral process	IEA
GO:0016407	Function	Acetyltransferase activity	EXP	12456660, 16135789, 20228809
GO:0016407	Function	Acetyltransferase activity	IDA	18722353, 23811396, 24939902
GO:0016407	Function	Acetyltransferase activity	IMP	12435739
GO:0016573	Process	Histone acetylation	IBA	21873635
GO:0016573	Process	Histone acetylation	IDA	25818647, 27256286
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016746	Function	Transferase activity, transferring acyl groups	IDA	17403783
GO:0018076	Process	N-terminal peptidyl-lysine acetylation	IDA	12435739
GO:0018215	Process	Protein phosphopantetheinylation	IEA
GO:0018393	Process	Internal peptidyl-lysine acetylation	IDA	17403783
GO:0018394	Process	Peptidyl-lysine acetylation	IDA	23811396, 23962722
GO:0030183	Process	B cell differentiation	IEA
GO:0030220	Process	Platelet formation	IEA
GO:0030324	Process	Lung development	IEA
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IMP	25514493
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IDA	23962722
GO:0031490	Function	Chromatin DNA binding	IBA	21873635
GO:0031648	Process	Protein destabilization	IMP	24939902
GO:0032092	Process	Positive regulation of protein binding	IEA
GO:0032481	Process	Positive regulation of type I interferon production	TAS
GO:0032993	Component	Protein-DNA complex	ISS	10362258
GO:0033613	Function	Activating transcription factor binding	IPI	20590529
GO:0034644	Process	Cellular response to UV	IDA	24939902
GO:0035257	Function	Nuclear hormone receptor binding	IPI	9862959
GO:0035264	Process	Multicellular organism growth	IEA
GO:0035855	Process	Megakaryocyte development	IEA
GO:0036268	Process	Swimming	IEA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	17403783
GO:0043627	Process	Response to estrogen	IDA	11581164
GO:0043923	Process	Positive regulation by host of viral transcription	IDA	16687403
GO:0043967	Process	Histone H4 acetylation	IMP	16325578
GO:0043969	Process	Histone H2B acetylation	IDA	23415232
GO:0045444	Process	Fat cell differentiation	ISS
GO:0045652	Process	Regulation of megakaryocyte differentiation	TAS
GO:0045721	Process	Negative regulation of gluconeogenesis	IDA	30193097
GO:0045747	Process	Positive regulation of Notch signaling pathway	TAS
GO:0045815	Process	Positive regulation of gene expression, epigenetic	IDA	25818647
GO:0045815	Process	Positive regulation of gene expression, epigenetic	TAS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	TAS	27256286
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12586840, 18722353, 23811396
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16325578
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0050681	Function	Androgen receptor binding	IPI	18487222
GO:0050821	Process	Protein stabilization	ISS
GO:0051059	Function	NF-kappaB binding	IPI	23811396
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	10518217, 25818647
GO:0051726	Process	Regulation of cell cycle	TAS
GO:0060325	Process	Face morphogenesis	IEA
GO:0060765	Process	Regulation of androgen receptor signaling pathway	IDA	18487222
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0061733	Function	Peptide-lysine-N-acetyltransferase activity	TAS
GO:0061920	Function	Protein propionyltransferase activity	IDA	17267393
GO:0061921	Process	Peptidyl-lysine propionylation	IDA	17267393
GO:0090043	Process	Regulation of tubulin deacetylation	IDA	18722353
GO:0097157	Function	Pre-mRNA intronic binding	IEA
GO:0097677	Function	STAT family protein binding	IPI	26479788
GO:0140065	Function	Peptide butyryltransferase activity	IDA	17267393, 29775581
GO:0140066	Process	Peptidyl-lysine crotonylation	IDA	25818647
GO:0140067	Process	Peptidyl-lysine butyrylation	IDA	17267393, 29775581
GO:0140068	Function	Histone crotonyltransferase activity	IDA	25818647
GO:0140069	Function	Histone butyryltransferase activity	IEA
GO:1900034	Process	Regulation of cellular response to heat	TAS
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IDA	23811396
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1904837	Process	Beta-catenin-TCF complex assembly	TAS
GO:1905636	Process	Positive regulation of RNA polymerase II regulatory region sequence-specific DNA binding	IDA	23811396

Other IDs

• MIM: 602700
• HGNC: 3373
• e!Ensembl: ENSG00000100393

Protein

• UniProt ID: Q09472
• Protein name: Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-)
• Protein function: Functions as histone acetyltransferase and regulates transcription via chromatin remodeling (PubMed:23415232, PubMed:23934153, PubMed:8945521). Acetylates all four core histones in nucleosomes. Histone acetylation gives an epigenetic tag for transcriptional activation (PubMed:23415232, PubMed:23934153, PubMed:8945521). Mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. Mediates acetylation of histone H3 at 'Lys-122' (H3K122ac), a modification that localizes at the surface of the histone octamer and stimulates transcription, possibly by promoting nucleosome instability. Mediates acetylation of histone H3 at 'Lys-27' (H3K27ac) (PubMed:23911289). Also functions as acetyltransferase for non-histone targets, such as ALX1, HDAC1, PRMT1 or SIRT2 (PubMed:12929931, PubMed:16762839, PubMed:18722353). Acetylates 'Lys-131' of ALX1 and acts as its coactivator (PubMed:12929931). Acetylates SIRT2 and is proposed to indirectly increase the transcriptional activity of TP53 through acetylation and subsequent attenuation of SIRT2 deacetylase function (PubMed:18722353). Acetylates HDAC1 leading to its inactivation and modulation of transcription (PubMed:16762839). Acetylates 'Lys-247' of EGR2 (By similarity). Acts as a TFAP2A-mediated transcriptional coactivator in presence of CITED2 (PubMed:12586840). Plays a role as a coactivator of NEUROD1-dependent transcription of the secretin and p21 genes and controls terminal differentiation of cells in the intestinal epithelium. Promotes cardiac myocyte enlargement. Can also mediate transcriptional repression. Acetylates FOXO1 and enhances its transcriptional activity (PubMed:15890677). Acetylates BCL6 wich disrupts its ability to recruit histone deacetylases and hinders its transcriptional repressor activity (PubMed:12402037). Participates in CLOCK or NPAS2-regulated rhythmic gene transcription; exhibits a circadian association with CLOCK or NPAS2, correlating with increase in PER1/2 mRNA and histone H3 acetylation on the PER1/2 promoter (PubMed:14645221). Acetylates MTA1 at 'Lys-626' which is essential for its transcriptional coactivator activity (PubMed:16617102). Acetylates XBP1 isoform 2; acetylation increases protein stability of XBP1 isoform 2 and enhances its transcriptional activity (PubMed:20955178). Acetylates PCNA; acetylation promotes removal of chromatin-bound PCNA and its degradation during nucleotide excision repair (NER) (PubMed:24939902). Acetylates MEF2D (PubMed:21030595). Acetylates and stabilizes ZBTB7B protein by antagonizing ubiquitin conjugation and degragation, this mechanism may be involved in CD4/CD8 lineage differentiation (PubMed:20810990). Acetylates GABPB1, impairing GABPB1 heterotetramerization and activity (By similarity). In addition to protein acetyltransferase, can use different acyl-CoA substrates, such as (2E)-butenoyl-CoA (crotonyl-CoA), butanoyl-CoA (butyryl-CoA), 2-hydroxyisobutanoyl-CoA (2-hydroxyisobutyryl-CoA), lactoyl-CoA or propanoyl-CoA (propionyl-CoA), and is able to mediate protein crotonylation, butyrylation, 2-hydroxyisobutyrylation, lactylation or propionylation, respectively (PubMed:17267393, PubMed:25818647, PubMed:29775581, PubMed:31645732). Acts as a histone crotonyltransferase; crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors (PubMed:25818647). Histone crotonyltransferase activity is dependent on the concentration of (2E)-butenoyl-CoA (crotonyl-CoA) substrate and such activity is weak when (2E)-butenoyl-CoA (crotonyl-CoA) concentration is low (PubMed:25818647). Also acts as a histone butyryltransferase; butyrylation marks active promoters (PubMed:17267393). Catalyzes histone lactylation in macrophages by using lactoyl-CoA directly derived from endogenous or exogenous lactate, leading to stimulates gene transcription (PubMed:31645732). Acts as a protein-lysine 2-hydroxyisobutyryltransferase; regulates glycolysis by mediating 2-hydroxyisobutyrylation of glycolytic enzymes (PubMed:29775581). Functions as a transcriptional coactivator for SMAD4 in the TGF-beta signaling pathway (PubMed:25514493). Acetylates PCK1 and promotes PCK1 anaplerotic activity (PubMed:30193097). Acetylates RXRA and RXRG (PubMed:17761950). ; (Microbial infection) In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes. Binds to and may be involved in the transforming capacity of the adenovirus E1A protein.
• PDB: 1L3E, 1P4Q, 2K8F, 2MH0, 2MZD, 3BIY, 3I3J, 3IO2, 3P57, 3T92, 4BHW, 4PZR, 4PZS, 4PZT, 5BT3, 5KJ2, 5LKT, 5LKU, 5LKX, 5LKZ, 5LPK, 5LPM, 5NU5, 5XZC, 6DS6, 6FGN, 6FGS, 6GYR, 6GYT, 6K4N, 6PF1, 6PGU, 6V8B, 6V8K, 6V8N, 6V90
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02135	zf-TAZ	338 → 414	TAZ zinc finger	Family
  PF02172	KIX	566 → 646	KIX domain	Domain
  PF00439	Bromodomain	1058 → 1144	Bromodomain	Domain
  PF06001	DUF902	1156 → 1195	Domain of Unknown Function (DUF902)	Domain
  PF08214	HAT_KAT11	1306 → 1612	Histone acetylation protein	Domain
  PF00569	ZZ	1664 → 1705	Zinc finger, ZZ type	Domain
  PF02135	zf-TAZ	1735 → 1806	TAZ zinc finger	Family
  PF09030	Creb_binding	1990 → 2098	Creb binding	Domain

• Sequence:

  MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
  INQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINS
  MVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
  GNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQ
  PLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMP
  NMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
  VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
  GDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQM
  PTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
  NPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
  KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPN
  AAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSM
  AQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNI
  PLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTP
  TPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPS
  LPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSST
  EVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELK
  TEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVD
  PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
  YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
  CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
  HHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGE
  VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
  YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
  SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKE
  LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
  SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
  CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
  WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
  SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
  CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTG
  QQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPG
  PPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHL
  EPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISP
  LKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPI
  PGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGG
  MSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYP
  PQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSP
  QQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHV
  SPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNS
  DLNSNLSQSTLDIH

• Sequence length: 2414