EIF2S2 (eukaryotic translation initiation factor 2 subunit beta)

Gene

• Entrez ID: 8894
• Gene name: Eukaryotic translation initiation factor 2 subunit beta
• Gene symbol: EIF2S2
• Synonyms: EIF2, EIF2B, EIF2beta, PPP1R67, eIF-2-beta
• Chromosome: 20
• Chromosome location: 20q11.22
• Summary: Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021922	hsa-miR-128-3p	Sequencing, PAR-CLIP	20371350
MIRT022382	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT028733	hsa-miR-27a-3p	Sequencing, PAR-CLIP	20371350
MIRT044047	hsa-miR-363-3p	CLASH	23622248
MIRT562403	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT562404	hsa-miR-4477b	PAR-CLIP	20371350
MIRT562405	hsa-miR-6892-5p	PAR-CLIP	20371350
MIRT562406	hsa-miR-8062	PAR-CLIP	20371350
MIRT562407	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT562408	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT562409	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT562410	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT562411	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT562412	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT562413	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT562414	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT562415	hsa-miR-548z	PAR-CLIP	20371350
MIRT562416	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT562417	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT562418	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT562419	hsa-miR-548ac	PAR-CLIP	20371350
MIRT562420	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT562421	hsa-miR-216a-3p	PAR-CLIP	20371350
MIRT562422	hsa-miR-3681-3p	PAR-CLIP	20371350

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001701	Process	In utero embryonic development	IEA
GO:0001731	Process	Formation of translation preinitiation complex	IBA	21873635
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IBA	21873635
GO:0002176	Process	Male germ cell proliferation	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003729	Function	MRNA binding	IBA	21873635
GO:0003743	Function	Translation initiation factor activity	IBA	21873635
GO:0003743	Function	Translation initiation factor activity	IDA	16289705
GO:0005515	Function	Protein binding	IPI	11959995, 16288713, 16932749, 25147208, 25609649, 28514442, 32814053
GO:0005634	Component	Nucleus	IDA	12426392
GO:0005737	Component	Cytoplasm	IDA	12426392
GO:0005829	Component	Cytosol	TAS
GO:0005850	Component	Eukaryotic translation initiation factor 2 complex	IBA	21873635
GO:0005850	Component	Eukaryotic translation initiation factor 2 complex	IDA	23063529
GO:0006413	Process	Translational initiation	TAS
GO:0008135	Function	Translation factor activity, RNA binding	TAS	3044606, 10805737
GO:0008584	Process	Male gonad development	IEA
GO:0031369	Function	Translation initiation factor binding	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:0055085	Process	Transmembrane transport	TAS

Other IDs

• MIM: 603908
• HGNC: 3266
• e!Ensembl: ENSG00000125977

Protein

• UniProt ID: P20042
• Protein name: Eukaryotic translation initiation factor 2 subunit 2 (Eukaryotic translation initiation factor 2 subunit beta) (eIF-2-beta)
• Protein function: eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.
• PDB: 6K71, 6K72, 6YBV, 6ZMW, 6ZP4, 7A09, 7D43
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01873	eIF-5_eIF-2B	192 → 308	Domain found in IF2B/IF5	Family

• Sequence:

  MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEED
  TRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIM
  LGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELL
  NRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFL
  LAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
  QCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN

• Sequence length: 333