EIF2S2 (eukaryotic translation initiation factor 2 subunit beta)

Gene

• Entrez ID: 8894
• Gene name: Eukaryotic translation initiation factor 2 subunit beta
• Gene symbol: EIF2S2
• Synonyms: EIF2, EIF2B, EIF2beta, PPP1R67, eIF-2-beta
• Chromosome: 20
• Chromosome location: 20q11.22
• Summary: Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gam

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021922	hsa-miR-128-3p	Sequencing	20371350
MIRT022382	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT028733	hsa-miR-27a-3p	Sequencing	20371350
MIRT044047	hsa-miR-363-3p	CLASH	23622248
MIRT562422	hsa-miR-3681-3p	PAR-CLIP	20371350
MIRT562421	hsa-miR-216a-3p	PAR-CLIP	20371350
MIRT021922	hsa-miR-128-3p	PAR-CLIP	20371350
MIRT028733	hsa-miR-27a-3p	PAR-CLIP	20371350
MIRT562420	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT562419	hsa-miR-548ac	PAR-CLIP	20371350
MIRT562418	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT562417	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT562416	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT562415	hsa-miR-548z	PAR-CLIP	20371350
MIRT562414	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT562413	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT562412	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT562411	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT562410	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT562409	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT562408	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT562407	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT562406	hsa-miR-8062	PAR-CLIP	20371350
MIRT562405	hsa-miR-6892-5p	PAR-CLIP	20371350
MIRT562404	hsa-miR-4477b	PAR-CLIP	20371350
MIRT562403	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT562422	hsa-miR-3681-3p	PAR-CLIP	20371350
MIRT562421	hsa-miR-216a-3p	PAR-CLIP	20371350
MIRT021922	hsa-miR-128-3p	PAR-CLIP	20371350
MIRT028733	hsa-miR-27a-3p	PAR-CLIP	20371350
MIRT562420	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT562419	hsa-miR-548ac	PAR-CLIP	20371350
MIRT562418	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT562417	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT562416	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT562415	hsa-miR-548z	PAR-CLIP	20371350
MIRT562414	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT562413	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT562412	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT562411	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT562410	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT562409	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT562408	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT562407	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT562406	hsa-miR-8062	PAR-CLIP	20371350
MIRT562405	hsa-miR-6892-5p	PAR-CLIP	20371350
MIRT562404	hsa-miR-4477b	PAR-CLIP	20371350
MIRT562403	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT957297	hsa-miR-1208	CLIP-seq
MIRT957298	hsa-miR-1269	CLIP-seq
MIRT957299	hsa-miR-1269b	CLIP-seq
MIRT957300	hsa-miR-186	CLIP-seq
MIRT957301	hsa-miR-324-5p	CLIP-seq
MIRT957302	hsa-miR-339-5p	CLIP-seq
MIRT957303	hsa-miR-33a	CLIP-seq
MIRT957304	hsa-miR-33b	CLIP-seq
MIRT957305	hsa-miR-34b	CLIP-seq
MIRT957306	hsa-miR-369-3p	CLIP-seq
MIRT957307	hsa-miR-374a	CLIP-seq
MIRT957308	hsa-miR-374b	CLIP-seq
MIRT957309	hsa-miR-421	CLIP-seq
MIRT957310	hsa-miR-4276	CLIP-seq
MIRT957311	hsa-miR-431	CLIP-seq
MIRT957312	hsa-miR-450b-5p	CLIP-seq
MIRT957313	hsa-miR-4520b-3p	CLIP-seq
MIRT957314	hsa-miR-4529-3p	CLIP-seq
MIRT957315	hsa-miR-4642	CLIP-seq
MIRT957316	hsa-miR-4708-3p	CLIP-seq
MIRT957317	hsa-miR-4709-5p	CLIP-seq
MIRT957318	hsa-miR-4711-5p	CLIP-seq
MIRT957319	hsa-miR-4766-3p	CLIP-seq
MIRT957320	hsa-miR-4775	CLIP-seq
MIRT957321	hsa-miR-488	CLIP-seq
MIRT957322	hsa-miR-505	CLIP-seq
MIRT957323	hsa-miR-518a-5p	CLIP-seq
MIRT957324	hsa-miR-527	CLIP-seq
MIRT957325	hsa-miR-548p	CLIP-seq
MIRT957303	hsa-miR-33a	CLIP-seq
MIRT957304	hsa-miR-33b	CLIP-seq
MIRT957311	hsa-miR-431	CLIP-seq
MIRT957316	hsa-miR-4708-3p	CLIP-seq
MIRT957318	hsa-miR-4711-5p	CLIP-seq
MIRT2218846	hsa-miR-29a	CLIP-seq
MIRT2218847	hsa-miR-29b	CLIP-seq
MIRT2218848	hsa-miR-29c	CLIP-seq
MIRT2218849	hsa-miR-3934	CLIP-seq
MIRT957309	hsa-miR-421	CLIP-seq
MIRT957311	hsa-miR-431	CLIP-seq
MIRT2218850	hsa-miR-4694-5p	CLIP-seq
MIRT957316	hsa-miR-4708-3p	CLIP-seq
MIRT957317	hsa-miR-4709-5p	CLIP-seq
MIRT957318	hsa-miR-4711-5p	CLIP-seq
MIRT2218851	hsa-miR-4731-3p	CLIP-seq
MIRT2218852	hsa-miR-4801	CLIP-seq
MIRT2218853	hsa-miR-496	CLIP-seq
MIRT957322	hsa-miR-505	CLIP-seq
MIRT2218854	hsa-miR-548a-5p	CLIP-seq
MIRT2218855	hsa-miR-548ab	CLIP-seq
MIRT2218856	hsa-miR-548ae	CLIP-seq
MIRT2218857	hsa-miR-548aj	CLIP-seq
MIRT2218858	hsa-miR-548ak	CLIP-seq
MIRT2218859	hsa-miR-548am	CLIP-seq
MIRT2218860	hsa-miR-548b-5p	CLIP-seq
MIRT2218861	hsa-miR-548c-5p	CLIP-seq
MIRT2218862	hsa-miR-548d-5p	CLIP-seq
MIRT2218863	hsa-miR-548h	CLIP-seq
MIRT2218864	hsa-miR-548i	CLIP-seq
MIRT2218865	hsa-miR-548j	CLIP-seq
MIRT2218866	hsa-miR-548k	CLIP-seq
MIRT2218867	hsa-miR-548l	CLIP-seq
MIRT2218868	hsa-miR-548w	CLIP-seq
MIRT2218869	hsa-miR-548x	CLIP-seq
MIRT2218870	hsa-miR-548y	CLIP-seq
MIRT2218871	hsa-miR-552	CLIP-seq
MIRT2218872	hsa-miR-559	CLIP-seq
MIRT2522184	hsa-miR-1200	CLIP-seq
MIRT2522185	hsa-miR-1202	CLIP-seq
MIRT2522186	hsa-miR-1227	CLIP-seq
MIRT2522187	hsa-miR-150	CLIP-seq
MIRT2522188	hsa-miR-151-5p	CLIP-seq
MIRT2522189	hsa-miR-151b	CLIP-seq
MIRT2522190	hsa-miR-3160-3p	CLIP-seq
MIRT2522191	hsa-miR-3194-5p	CLIP-seq
MIRT2522192	hsa-miR-374c	CLIP-seq
MIRT2218849	hsa-miR-3934	CLIP-seq
MIRT2522193	hsa-miR-3972	CLIP-seq
MIRT957309	hsa-miR-421	CLIP-seq
MIRT2522194	hsa-miR-4268	CLIP-seq
MIRT957311	hsa-miR-431	CLIP-seq
MIRT2522195	hsa-miR-4324	CLIP-seq
MIRT2522196	hsa-miR-4426	CLIP-seq
MIRT2522197	hsa-miR-4448	CLIP-seq
MIRT2522198	hsa-miR-4487	CLIP-seq
MIRT2522199	hsa-miR-4502	CLIP-seq
MIRT2522200	hsa-miR-455-5p	CLIP-seq
MIRT2522201	hsa-miR-4647	CLIP-seq
MIRT2522202	hsa-miR-4662b	CLIP-seq
MIRT2218850	hsa-miR-4694-5p	CLIP-seq
MIRT957316	hsa-miR-4708-3p	CLIP-seq
MIRT957317	hsa-miR-4709-5p	CLIP-seq
MIRT957318	hsa-miR-4711-5p	CLIP-seq
MIRT2522203	hsa-miR-4713-5p	CLIP-seq
MIRT2522204	hsa-miR-4714-5p	CLIP-seq
MIRT2218853	hsa-miR-496	CLIP-seq
MIRT2522205	hsa-miR-503	CLIP-seq
MIRT957322	hsa-miR-505	CLIP-seq
MIRT2522206	hsa-miR-532-3p	CLIP-seq
MIRT2522207	hsa-miR-544b	CLIP-seq
MIRT2218854	hsa-miR-548a-5p	CLIP-seq
MIRT2218855	hsa-miR-548ab	CLIP-seq
MIRT2218858	hsa-miR-548ak	CLIP-seq
MIRT2218860	hsa-miR-548b-5p	CLIP-seq
MIRT2522208	hsa-miR-548c-3p	CLIP-seq
MIRT2218861	hsa-miR-548c-5p	CLIP-seq
MIRT2218862	hsa-miR-548d-5p	CLIP-seq
MIRT2218863	hsa-miR-548h	CLIP-seq
MIRT2218864	hsa-miR-548i	CLIP-seq
MIRT2218865	hsa-miR-548j	CLIP-seq
MIRT2218866	hsa-miR-548k	CLIP-seq
MIRT2218867	hsa-miR-548l	CLIP-seq
MIRT2218868	hsa-miR-548w	CLIP-seq
MIRT2218870	hsa-miR-548y	CLIP-seq
MIRT2218871	hsa-miR-552	CLIP-seq
MIRT2522209	hsa-miR-558	CLIP-seq
MIRT2218872	hsa-miR-559	CLIP-seq
MIRT2522210	hsa-miR-655	CLIP-seq
MIRT2522211	hsa-miR-885-3p	CLIP-seq
MIRT2522212	hsa-miR-938	CLIP-seq
MIRT2522185	hsa-miR-1202	CLIP-seq
MIRT2522186	hsa-miR-1227	CLIP-seq
MIRT2522187	hsa-miR-150	CLIP-seq
MIRT2679877	hsa-miR-3127-3p	CLIP-seq
MIRT2522191	hsa-miR-3194-5p	CLIP-seq
MIRT2679878	hsa-miR-3664-3p	CLIP-seq
MIRT2522192	hsa-miR-374c	CLIP-seq
MIRT2218849	hsa-miR-3934	CLIP-seq
MIRT2522193	hsa-miR-3972	CLIP-seq
MIRT957309	hsa-miR-421	CLIP-seq
MIRT957311	hsa-miR-431	CLIP-seq
MIRT2522196	hsa-miR-4426	CLIP-seq
MIRT2522200	hsa-miR-455-5p	CLIP-seq
MIRT2522201	hsa-miR-4647	CLIP-seq
MIRT2522202	hsa-miR-4662b	CLIP-seq
MIRT2218850	hsa-miR-4694-5p	CLIP-seq
MIRT957316	hsa-miR-4708-3p	CLIP-seq
MIRT957317	hsa-miR-4709-5p	CLIP-seq
MIRT957318	hsa-miR-4711-5p	CLIP-seq
MIRT2522203	hsa-miR-4713-5p	CLIP-seq
MIRT2522204	hsa-miR-4714-5p	CLIP-seq
MIRT2218853	hsa-miR-496	CLIP-seq
MIRT957322	hsa-miR-505	CLIP-seq
MIRT2522206	hsa-miR-532-3p	CLIP-seq
MIRT2218854	hsa-miR-548a-5p	CLIP-seq
MIRT2218855	hsa-miR-548ab	CLIP-seq
MIRT2218858	hsa-miR-548ak	CLIP-seq
MIRT2218860	hsa-miR-548b-5p	CLIP-seq
MIRT2522208	hsa-miR-548c-3p	CLIP-seq
MIRT2218861	hsa-miR-548c-5p	CLIP-seq
MIRT2218862	hsa-miR-548d-5p	CLIP-seq
MIRT2218863	hsa-miR-548h	CLIP-seq
MIRT2218864	hsa-miR-548i	CLIP-seq
MIRT2218865	hsa-miR-548j	CLIP-seq
MIRT2218866	hsa-miR-548k	CLIP-seq
MIRT2218867	hsa-miR-548l	CLIP-seq
MIRT2218868	hsa-miR-548w	CLIP-seq
MIRT2218870	hsa-miR-548y	CLIP-seq
MIRT2218871	hsa-miR-552	CLIP-seq
MIRT2218872	hsa-miR-559	CLIP-seq
MIRT2522210	hsa-miR-655	CLIP-seq
MIRT2679879	hsa-miR-873	CLIP-seq
MIRT2522211	hsa-miR-885-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001701	Process	In utero embryonic development	IEA
GO:0001731	Process	Formation of translation preinitiation complex	IBA	21873635
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IBA	21873635
GO:0002176	Process	Male germ cell proliferation	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003729	Function	MRNA binding	IBA	21873635
GO:0003743	Function	Translation initiation factor activity	IBA	21873635
GO:0003743	Function	Translation initiation factor activity	IDA	16289705
GO:0005515	Function	Protein binding	IPI	11959995, 16288713, 16932749, 25147208, 25609649, 28514442, 32814053
GO:0005634	Component	Nucleus	IDA	12426392
GO:0005737	Component	Cytoplasm	IDA	12426392
GO:0005829	Component	Cytosol	TAS
GO:0005850	Component	Eukaryotic translation initiation factor 2 complex	IBA	21873635
GO:0005850	Component	Eukaryotic translation initiation factor 2 complex	IDA	23063529
GO:0006413	Process	Translational initiation	TAS
GO:0008135	Function	Translation factor activity, RNA binding	TAS	3044606, 10805737
GO:0008584	Process	Male gonad development	IEA
GO:0031369	Function	Translation initiation factor binding	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:0055085	Process	Transmembrane transport	TAS

Other IDs

• MIM: 603908
• HGNC: 3266
• e!Ensembl: ENSG00000125977

Protein

• UniProt ID: P20042
• Protein name: Eukaryotic translation initiation factor 2 subunit 2 (Eukaryotic translation initiation factor 2 subunit beta) (eIF2-beta)
• Protein function: Component of the eIF2 complex that functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA (PubMed:31836389). This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form the
• PDB: 6K71, 6K72, 6YBV, 6ZMW, 6ZP4, 7A09, 7D43, 7QP6, 8OZ0, 8PJ1, 8PPL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01873	eIF-5_eIF-2B	192 → 308	Domain found in IF2B/IF5	Family

• Sequence:

  MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEED
  TRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIM
  LGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELL
  NRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFL
  LAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
  QCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN

• Sequence length: 333