EGR1 (early growth response 1)

Gene

• Entrez ID: 1958
• Gene name: Early growth response 1
• Gene symbol: EGR1
• Synonyms: AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225
• Chromosome: 5
• Chromosome location: 5q31.2
• Summary: The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppressor gene. [provided by RefSeq, Dec 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004130	hsa-miR-192-5p	Microarray	16822819
MIRT004130	hsa-miR-192-5p	Microarray	19074876
MIRT006540	hsa-miR-183-5p	Luciferase reporter assay	21118966
MIRT023192	hsa-miR-124-3p	Microarray	18668037
MIRT023192	hsa-miR-124-3p	Luciferase reporter assay, Western blot	27569005
MIRT024271	hsa-miR-215-5p	Microarray	19074876
MIRT054161	hsa-miR-191-5p	Immunoprecipitation, In situ hybridization, Luciferase assay, Microarray, Northern blot, QRTPCR, Western blot	23505378
MIRT440744	hsa-miR-377-3p	HITS-CLIP	24374217
MIRT440745	hsa-miR-487a-3p	HITS-CLIP	24374217
MIRT734446	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28077323

Transcription factors

Transcription factor	Regulation	Reference
ATF5	Unknown	19531563
BRCA1	Unknown	20103632
ETS1	Activation	19074849
ETS1	Unknown	9207063
ETS2	Unknown	9207063
FOXO1	Repression	22865884
HDAC1	Repression	21983014
MAML1	Activation	23029358
NFKB1	Repression	21983014
NKX2-3	Unknown	21968973
RBMX	Repression	16707624
RELA	Repression	21983014
SP1	Activation	8349585
SP1	Unknown	10826704
TP53	Unknown	16990849

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	19307576
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	18718911
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	14979875, 19307576
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19307576
GO:0001666	Process	Response to hypoxia	ISS
GO:0002931	Process	Response to ischemia	ISS
GO:0003677	Function	DNA binding	IDA	12560508
GO:0003700	Function	DNA-binding transcription factor activity	IDA	12560508
GO:0005515	Function	Protein binding	IPI	19057511, 21743491
GO:0005634	Component	Nucleus	IDA	19057511, 20018936, 20363028
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	19057511, 20363028
GO:0005737	Component	Cytoplasm	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0008270	Function	Zinc ion binding	IDA	25258363
GO:0009749	Process	Response to glucose	IEA
GO:0010385	Function	Double-stranded methylated DNA binding	IDA	25258363
GO:0010628	Process	Positive regulation of gene expression	IMP	24244514
GO:0030217	Process	T cell differentiation	IEA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0032722	Process	Positive regulation of chemokine production	ISS
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032868	Process	Response to insulin	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0033233	Process	Regulation of protein sumoylation	IDA	19057511
GO:0035035	Function	Histone acetyltransferase binding	IPI	20018936
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	1662794, 25258363
GO:0044729	Function	Hemi-methylated DNA-binding	IDA	25258363
GO:0044849	Process	Estrous cycle	ISS
GO:0045475	Process	Locomotor rhythm	ISS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	12560508
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19057511, 26089202
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	14979875
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	14979875, 20018936
GO:0046886	Process	Positive regulation of hormone biosynthetic process	ISS
GO:0060086	Process	Circadian temperature homeostasis	ISS
GO:0060337	Process	Type I interferon signaling pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IMP	20018936
GO:0071480	Process	Cellular response to gamma radiation	IEA
GO:0071504	Process	Cellular response to heparin	ISS
GO:0071506	Process	Cellular response to mycophenolic acid	ISS
GO:0072110	Process	Glomerular mesangial cell proliferation	ISS
GO:0072303	Process	Positive regulation of glomerular metanephric mesangial cell proliferation	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0098759	Process	Cellular response to interleukin-8	IDA	20363028
GO:1901216	Process	Positive regulation of neuron death	ISS
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	19307576
GO:1902949	Process	Positive regulation of tau-protein kinase activity	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IDA	20363028
GO:2000182	Process	Regulation of progesterone biosynthetic process	ISS

Other IDs

• MIM: 128990
• HGNC: 3238
• e!Ensembl: ENSG00000120738

Protein

• UniProt ID: P18146
• Protein name: Early growth response protein 1 (EGR-1) (AT225) (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox-24)
• Protein function: Transcriptional regulator (PubMed:20121949). Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes (By similarity). Binds double-stranded target DNA, irrespective of the cytosine methylation status (PubMed:25258363, PubMed:25999311). Regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. Plays a role in the regulation of cell survival, proliferation and cell death. Activates expression of p53/TP53 and TGFB1, and thereby helps prevent tumor formation. Required for normal progress through mitosis and normal proliferation of hepatocytes after partial hepatectomy. Mediates responses to ischemia and hypoxia; regulates the expression of proteins such as IL1B and CXCL2 that are involved in inflammatory processes and development of tissue damage after ischemia. Regulates biosynthesis of luteinizing hormone (LHB) in the pituitary (By similarity). Regulates the amplitude of the expression rhythms of clock genes: ARNTL/BMAL1, PER2 and NR1D1 in the liver via the activation of PER1 (clock repressor) transcription. Regulates the rhythmic expression of core-clock gene ARNTL/BMAL1 in the suprachiasmatic nucleus (SCN) (By similarity).
• PDB: 4R2A, 4R2C, 4R2D, 4X9J, 5N14
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11928	DUF3446	135 → 219	Early growth response N-terminal domain	Domain
  PF00096	zf-C2H2	338 → 362	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	368 → 390	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	396 → 418	Zinc finger, C2H2 type	Domain
  PF11914	DUF3432	424 → 462	Domain of unknown function (DUF3432)	Repeat
  PF11914	DUF3432	452 → 530	Domain of unknown function (DUF3432)	Repeat

• Sequence:

  MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
  NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
  YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
  SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY
  PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
  SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
  IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
  QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
  TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI
  EIC

• Sequence length: 543