DERL2 (derlin 2)

Gene

• Entrez ID: 51009
• Gene name: Derlin 2
• Gene symbol: DERL2
• Synonyms: CGI-101, DERtrin-2, F-LAN-1, F-LANa, FLANa, derlin-2
• Chromosome: 17
• Chromosome location: 17p13.2
• Summary: Proteins that are unfolded or misfolded in the endoplasmic reticulum (ER) must be refolded or degraded to maintain the homeostasis of the ER. DERL2 is involved in the degradation of misfolded glycoproteins in the ER (Oda et al., 2006 [PubMed 16449189]).[supplied by OMIM, Mar 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT042933	hsa-miR-324-3p	CLASH	23622248
MIRT478164	hsa-miR-1468-5p	PAR-CLIP	23592263
MIRT478165	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT478166	hsa-miR-374c-5p	PAR-CLIP	23592263
MIRT478167	hsa-miR-655-3p	PAR-CLIP	23592263
MIRT624173	hsa-miR-4769-3p	HITS-CLIP	23824327
MIRT624174	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT624175	hsa-miR-1231	HITS-CLIP	23824327
MIRT624176	hsa-miR-632	HITS-CLIP	23824327
MIRT624177	hsa-miR-4288	HITS-CLIP	23824327
MIRT624178	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT624179	hsa-miR-6755-3p	HITS-CLIP	23824327
MIRT624180	hsa-miR-4469	HITS-CLIP	23824327
MIRT624181	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT624182	hsa-miR-1470	HITS-CLIP	23824327
MIRT624183	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT624184	hsa-miR-548b-3p	HITS-CLIP	23824327
MIRT640116	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT640243	hsa-miR-6077	HITS-CLIP	23824327
MIRT640244	hsa-miR-6859-5p	HITS-CLIP	23824327
MIRT640245	hsa-miR-3916	HITS-CLIP	23824327
MIRT640246	hsa-miR-3125	HITS-CLIP	23824327
MIRT640247	hsa-miR-5680	HITS-CLIP	23824327
MIRT640248	hsa-miR-7-2-3p	HITS-CLIP	23824327
MIRT640249	hsa-miR-7-1-3p	HITS-CLIP	23824327
MIRT640250	hsa-miR-3121-3p	HITS-CLIP	23824327
MIRT659057	hsa-miR-222-3p	HITS-CLIP	23824327
MIRT659058	hsa-miR-221-3p	HITS-CLIP	23824327
MIRT659059	hsa-miR-548v	HITS-CLIP	23824327
MIRT659060	hsa-miR-187-5p	HITS-CLIP	23824327
MIRT708328	hsa-miR-500a-3p	HITS-CLIP	19536157
MIRT708329	hsa-miR-8059	HITS-CLIP	19536157
MIRT708330	hsa-miR-4471	HITS-CLIP	19536157
MIRT708331	hsa-miR-1292-5p	HITS-CLIP	19536157
MIRT708332	hsa-miR-4252	HITS-CLIP	19536157
MIRT708333	hsa-miR-4646-5p	HITS-CLIP	19536157
MIRT708334	hsa-miR-204-3p	HITS-CLIP	19536157
MIRT708335	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT708336	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT708337	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT708338	hsa-miR-4793-5p	HITS-CLIP	19536157

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000839	Component	Hrd1p ubiquitin ligase ERAD-L complex	IBA	21873635
GO:0001967	Process	Suckling behavior	IEA
GO:0005047	Function	Signal recognition particle binding	IDA	26565908
GO:0005515	Function	Protein binding	IPI	16449189, 25416956, 32296183
GO:0005769	Component	Early endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	15215855
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	11500051
GO:0016020	Component	Membrane	HDA	19946888
GO:0016032	Process	Viral process	IEA
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	IBA	21873635
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	IDA	16449189
GO:0030307	Process	Positive regulation of cell growth	IDA	11500051
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	IBA	21873635
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	IMP	16449189
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IBA	21873635
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IDA	16449189
GO:0030970	Process	Retrograde protein transport, ER to cytosol	IMP	16449189
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	26565908
GO:0051787	Function	Misfolded protein binding	IBA	21873635
GO:1904153	Process	Negative regulation of retrograde protein transport, ER to cytosol	IMP	25660456
GO:1904380	Process	Endoplasmic reticulum mannose trimming	TAS
GO:1990381	Function	Ubiquitin-specific protease binding	IBA	21873635

Other IDs

• MIM: 610304
• HGNC: 17943
• e!Ensembl: ENSG00000072849

Protein

• UniProt ID: Q9GZP9
• Protein name: Derlin-2 (Degradation in endoplasmic reticulum protein 2) (DERtrin-2) (Der1-like protein 2) (F-LAN-1) (F-LANa)
• Protein function: Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal glycoproteins, but not that of misfolded nonglycoproteins. May act by forming a channel that allows the retrotranslocation of misfolded glycoproteins into the cytosol where they are ubiquitinated and degraded by the proteasome. May mediate the interaction between VCP and misfolded glycoproteins (PubMed:16186509, PubMed:16449189). May also be involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation (PubMed:26565908). ; (Microbial infection) In contrast to DERL1, it is not involved in the degradation of MHC class I heavy chains following infection by cytomegaloviruses.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04511	DER1	13 → 203	Der1-like family	Family

• Sequence:

  MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITN
  FLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFL
  GQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH
  IYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG

• Sequence length: 239