GediPNet logo

DEFB1 (defensin beta 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1672
Gene nameGene Name - the full gene name approved by the HGNC.
Defensin beta 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
DEFB1
SynonymsGene synonyms aliases
BD1, DEFB-1, DEFB101, HBD1
ChromosomeChromosome number
8
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p23.1
SummarySummary of gene provided in NCBI Entrez Gene.
Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithel
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT755820 hsa-miR-186-5p Western blotting, qRT-PCR 36678471
MIRT755821 hsa-miR-340-5p Western blotting, qRT-PCR 36678471
MIRT931952 hsa-miR-3163 CLIP-seq
MIRT931953 hsa-miR-340 CLIP-seq
MIRT931954 hsa-miR-579 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
HDAC1 Unknown 23185513
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002227 Process Innate immune response in mucosa IBA 21873635
GO:0002227 Process Innate immune response in mucosa IDA 12860195
GO:0005515 Function Protein binding IPI 25122636, 32296183
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P60022
Protein name Beta-defensin 1 (BD-1) (hBD-1) (Defensin, beta 1)
Protein function Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is impo
PDB 1E4S , 1IJU , 1IJV , 1KJ5 , 2NLB , 2NLC , 2NLD , 2NLE , 2NLF , 2NLG , 2NLH , 2NLP , 2NLQ , 2NLS , 2PLZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00711 Defensin_beta
33 68
Beta defensin
Domain
Sequence
MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY
RGKAKCCK
Sequence length 68
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412