DDO (D-aspartate oxidase)

Gene

• Entrez ID: 8528
• Gene name: D-aspartate oxidase
• Gene symbol: DDO
• Synonyms: DASOX, DDO-1, DDO-2
• Chromosome: 6
• Chromosome location: 6q21
• Summary: The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2019]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT663078	hsa-miR-5701	HITS-CLIP	23824327
MIRT663079	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT663080	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT663081	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT663082	hsa-miR-6750-3p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003884	Function	D-amino-acid oxidase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	9820813
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005777	Component	Peroxisome	NAS	9820813
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006533	Process	Aspartate catabolic process	IBA	21873635
GO:0006625	Process	Protein targeting to peroxisome	TAS
GO:0007320	Process	Insemination	IEA
GO:0007625	Process	Grooming behavior	IEA
GO:0008445	Function	D-aspartate oxidase activity	IBA	21873635
GO:0008445	Function	D-aspartate oxidase activity	IDA	20603179
GO:0019478	Process	D-amino acid catabolic process	IBA	21873635
GO:0019478	Process	D-amino acid catabolic process	IDA	20603179
GO:0034641	Process	Cellular nitrogen compound metabolic process	TAS
GO:0042445	Process	Hormone metabolic process	IEA
GO:0071949	Function	FAD binding	IDA	20603179

Other IDs

• MIM: 124450
• HGNC: 2727
• e!Ensembl: ENSG00000203797

Protein

• UniProt ID: Q99489
• Protein name: D-aspartate oxidase (DASOX) (DDO) (EC 1.4.3.1)
• Protein function: Selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate.
• PDB: 6RKF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01266	DAO	5 → 324	FAD dependent oxidoreductase	Domain

• Sequence:

  MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTP
  IHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMT
  EAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVV
  NCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKG
  DWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPV
  VHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL

• Sequence length: 341