DCN (decorin)

Gene

• Entrez ID: 1634
• Gene name: Decorin
• Gene symbol: DCN
• Synonyms: CSCD, DSPG2, PG40, PGII, PGS2, SLRR1B
• Chromosome: 12
• Chromosome location: 12q21.33
• Summary: This gene encodes a member of the small leucine-rich proteoglycan family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. This protein plays a role in collagen fibril assembly. Binding of this protein to multiple cell surface receptors mediates its role in tumor suppression, including a stimulatory effect on autophagy and inflammation and an inhibitory effect on angiogenesis and tumorigenesis. This gene and the related gene biglycan are thought to be the result of a gene duplication. Mutations in this gene are associated with congenital stromal corneal dystrophy in human patients. [provided by RefSeq, Nov 2015]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs80338741	A>-	Pathogenic	Frameshift variant, coding sequence variant, 3 prime UTR variant
rs80338742	G>-	Pathogenic	Frameshift variant, coding sequence variant, 3 prime UTR variant
rs397515545	C>-	Pathogenic	Frameshift variant, coding sequence variant, 3 prime UTR variant
rs587777258	T>-	Pathogenic	Coding sequence variant, frameshift variant, 3 prime UTR variant

Transcription factors

Transcription factor	Regulation	Reference
JUN	Repression	8798756
NR1H4	Activation	18514055

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IEA
GO:0001890	Process	Placenta development	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	1747115, 11598131, 20026052, 25331875, 25789606
GO:0005518	Function	Collagen binding	IEA
GO:0005539	Function	Glycosaminoglycan binding	IEA
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	TAS
GO:0005589	Component	Collagen type VI trimer	IEA
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005796	Component	Golgi lumen	TAS
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0007568	Process	Aging	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009887	Process	Animal organ morphogenesis	TAS	7961765
GO:0010508	Process	Positive regulation of autophagy	IDA	23798385
GO:0010596	Process	Negative regulation of endothelial cell migration	IDA	23798385
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IDA	23798385
GO:0016239	Process	Positive regulation of macroautophagy	IDA	23798385
GO:0016239	Process	Positive regulation of macroautophagy	IGI	23798385
GO:0016525	Process	Negative regulation of angiogenesis	IDA	23978385
GO:0019800	Process	Peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan	IEA
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	ISS
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	RCA	20551380, 25037231, 27559042, 28327460, 28675934
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0030206	Process	Chondroitin sulfate biosynthetic process	TAS
GO:0030207	Process	Chondroitin sulfate catabolic process	TAS
GO:0030208	Process	Dermatan sulfate biosynthetic process	TAS
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0042060	Process	Wound healing	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	23798385
GO:0047485	Function	Protein N-terminus binding	IEA
GO:0050840	Function	Extracellular matrix binding	IEA
GO:0051901	Process	Positive regulation of mitochondrial depolarization	IGI	23798385
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	25037231, 27559042, 28327460, 28675934
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	20551380
GO:0062023	Component	Collagen-containing extracellular matrix	ISS	22261194
GO:0090141	Process	Positive regulation of mitochondrial fission	IGI	23798385
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IDA	23798385

Other IDs

• MIM: 125255
• HGNC: 2705
• e!Ensembl: ENSG00000011465

Protein

• UniProt ID: P07585
• Protein name: Decorin (Bone proteoglycan II) (PG-S2) (PG40)
• Protein function: May affect the rate of fibrils formation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01462	LRRNT	53 → 80	Leucine rich repeat N-terminal domain	Family
  PF13855	LRR_8	81 → 141	Leucine rich repeat	Repeat
  PF13855	LRR_8	150 → 218	Leucine rich repeat	Repeat
  PF13855	LRR_8	221 → 281	Leucine rich repeat	Repeat

• Sequence:

  MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQC
  HLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKV
  SPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIE
  LGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAAS
  LKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLH
  NNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

• Sequence length: 359