CXCL1 (C-X-C motif chemokine ligand 1)

Gene

• Entrez ID: 2919
• Gene name: C-X-C motif chemokine ligand 1
• Gene symbol: CXCL1
• Synonyms: FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1
• Chromosome: 4
• Chromosome location: 4q13.3
• Summary: This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Sep 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023084	hsa-miR-124-3p	Microarray	18668037
MIRT023999	hsa-miR-1-3p	Microarray	18668037
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327

Transcription factors

Transcription factor	Regulation	Reference
BRCA1	Repression	22120723
CEBPD	Activation	23028973
GATA3	Repression	22120723
HMGA1	Unknown	11112786;7479086
NFKB1	Activation	10530453;15958549
NFKB1	Unknown	11112786;16040075;7479086
PARP1	Unknown	11112786
RELA	Activation	10530453;15958549
RELA	Unknown	11112786;16040075
SP1	Unknown	11112786;7479086

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	TAS	9079638, 10820279
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006935	Process	Chemotaxis	TAS	10820279
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	9725262, 10820279
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007399	Process	Nervous system development	TAS	9058825
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0008047	Function	Enzyme activator activity	TAS	9079638
GO:0008083	Function	Growth factor activity	TAS	8380167
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9551928
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0030036	Process	Actin cytoskeleton organization	TAS	9725262
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0035556	Process	Intracellular signal transduction	TAS	9551928
GO:0035580	Component	Specific granule lumen	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045236	Function	CXCR chemokine receptor binding	IBA	21873635
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	21873635
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA	21873635
GO:1904724	Component	Tertiary granule lumen	TAS

Other IDs

• MIM: 155730
• HGNC: 4602
• e!Ensembl: ENSG00000163739

Protein

• UniProt ID: P09341
• Protein name: Growth-regulated alpha protein (C-X-C motif chemokine 1) (GRO-alpha(1-73)) (Melanoma growth stimulatory activity) (MGSA) (Neutrophil-activating protein 3) (NAP-3) [Cleaved into: GRO-alpha(4-73); GRO-alpha(5-73); GRO-alpha(6-73)]
• Protein function: Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
• PDB: 1MGS, 1MSG, 1MSH, 1ROD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	41 → 100	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
  NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

• Sequence length: 107