GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

CTNNB1 (catenin beta 1)

Gene

1499

Catenin beta 1

CTNNB1

CTNNB, EVR7, MRD19, NEDSDV, armadillo

3p22.1

The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded prot

Show/Hide all(89)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28931588	G>A,C,T	Pathogenic, other, likely-pathogenic	Missense variant, coding sequence variant
rs28931589	G>A,C,T	Uncertain-significance, pathogenic, other, likely-pathogenic	Missense variant, coding sequence variant
rs77064436	T>C,G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913228	T>C,G	Likely-pathogenic	Missense variant, coding sequence variant
rs121913394	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs121913395	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs121913396	A>C,G,T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913399	G>A,C	Likely-pathogenic	Missense variant, coding sequence variant
rs121913400	C>A,G,T	Pathogenic, pathogenic-likely-pathogenic, likely-pathogenic, other	Missense variant, coding sequence variant
rs121913403	C>A,G,T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913407	T>C,G	Pathogenic, pathogenic-likely-pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913409	C>A,G,T	Pathogenic, pathogenic-likely-pathogenic, likely-pathogenic, other	Missense variant, coding sequence variant
rs121913412	A>C,G,T	Pathogenic, conflicting-interpretations-of-pathogenicity, likely-pathogenic, other	Missense variant, coding sequence variant
rs121913413	C>A,T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913416	TTAGTCACTGGCAGCAACAGTCTTACCTGGACTCTGGAATCCATTCTGGTG>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs121913417	GGCAGCAACAGTCTTACCTGGACT>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs376393123	C>G,T	Pathogenic	Missense variant, coding sequence variant, stop gained
rs397514554	C>T	Pathogenic	Coding sequence variant, stop gained
rs398122907	TTCT>-	Pathogenic	Coding sequence variant, frameshift variant
rs483352717	G>A	Likely-pathogenic	Coding sequence variant, synonymous variant
rs587776850	TCT>-	Other, pathogenic	Coding sequence variant, inframe deletion
rs587777412	->A	Pathogenic	Coding sequence variant, frameshift variant
rs748294403	C>A,T	Pathogenic	Stop gained, coding sequence variant, synonymous variant
rs748653573	C>A,T	Pathogenic	Missense variant, intron variant, coding sequence variant
rs750402920	T>C,G	Pathogenic	Stop gained, coding sequence variant, synonymous variant
rs775104326	C>A,T	Pathogenic	Coding sequence variant, stop gained, synonymous variant
rs778624338	C>A,T	Pathogenic	Coding sequence variant, stop gained, synonymous variant
rs797044875	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs863224864	T>G	Likely-pathogenic	Missense variant, coding sequence variant
rs864309577	C>T	Pathogenic	Stop gained, coding sequence variant
rs886039332	C>T	Pathogenic, likely-pathogenic	Stop gained, coding sequence variant
rs886041281	->A	Pathogenic	Stop gained, coding sequence variant
rs886041444	CT>-	Pathogenic	Frameshift variant, coding sequence variant
rs886041553	G>A	Pathogenic	Stop gained, coding sequence variant
rs1057519379	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1057519380	->TAGCTATCGTTCTTTT	Pathogenic	Intron variant, stop gained, coding sequence variant
rs1057519836	A>C,G,T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519837	C>G,T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519886	T>A,C,G	Likely-pathogenic	Missense variant, coding sequence variant
rs1057520556	A>T	Pathogenic	Stop gained, coding sequence variant
rs1057520730	T>A	Pathogenic	Stop gained, coding sequence variant
rs1057521882	G>C	Likely-pathogenic	Splice acceptor variant, intron variant
rs1064793509	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs1064793948	T>-	Pathogenic	Frameshift variant, coding sequence variant
rs1064796240	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1064796453	C>A,T	Pathogenic	Stop gained, synonymous variant, coding sequence variant
rs1064796646	G>C	Pathogenic	Intron variant
rs1131691585	C>G	Likely-pathogenic	Intron variant
rs1131691736	AGCTGCTATG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1131692181	C>T	Pathogenic	Stop gained, coding sequence variant
rs1369821061	C>A,T	Pathogenic	Synonymous variant, coding sequence variant, stop gained
rs1553630279	C>T	Pathogenic	Stop gained, coding sequence variant
rs1553630304	->CAAGATGATGCAGAACTTGCCACACGTGCAATCCCTGAACTGAC	Pathogenic	Inframe insertion, stop gained, coding sequence variant
rs1553630458	TC>-	Pathogenic	Frameshift variant, coding sequence variant
rs1553630472	C>T	Pathogenic	Stop gained, coding sequence variant
rs1553630507	ACA>CC	Pathogenic	Frameshift variant, coding sequence variant
rs1553630789	A>G	Pathogenic	Splice acceptor variant
rs1553630795	->G	Pathogenic	Frameshift variant, coding sequence variant
rs1553631770	A>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1553631783	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1553631845	CT>G	Pathogenic	Frameshift variant, coding sequence variant
rs1553631860	C>T	Pathogenic	Stop gained, coding sequence variant
rs1553631896	->A	Pathogenic	Frameshift variant, coding sequence variant
rs1553632001	G>C	Pathogenic	Synonymous variant, coding sequence variant
rs1553632357	G>T	Likely-pathogenic	Stop gained, coding sequence variant
rs1553632361	AG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1553632412	G>A	Pathogenic	Stop gained, coding sequence variant
rs1553632414	T>C,G	Pathogenic	Splice donor variant
rs1559468403	G>C	Pathogenic	Splice donor variant
rs1559470315	CCACAAGCAG>T	Likely-pathogenic	Inframe indel, coding sequence variant
rs1559474040	C>T	Pathogenic	Stop gained, coding sequence variant
rs1559474311	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1559474364	A>T	Pathogenic	Stop gained, coding sequence variant
rs1559474557	C>T	Pathogenic	Stop gained, coding sequence variant
rs1559474966	C>T	Pathogenic	Stop gained, coding sequence variant
rs1559477241	G>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1559478415	->A	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs1575315766	->T	Pathogenic	Frameshift variant, coding sequence variant
rs1575316657	->G	Pathogenic	Frameshift variant, coding sequence variant
rs1575317915	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1575320216	ATCT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1575328856	CTGTCTTT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1575329479	CTTC>-	Pathogenic	Frameshift variant, coding sequence variant
rs1575330336	->T	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1575333081	->A	Pathogenic	Frameshift variant, coding sequence variant
rs1575334103	G>T	Pathogenic	Stop gained, coding sequence variant
rs1575334396	->TG	Pathogenic	Frameshift variant, coding sequence variant
rs1575337368	->C	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs1575339920	A>-	Likely-pathogenic	Frameshift variant, intron variant, coding sequence variant

Show/Hide all(314)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001175	hsa-miR-200a-3p	qRT-PCR, Luciferase reporter assay, Western blot	19703993
MIRT001175	hsa-miR-200a-3p	qRT-PCR, Luciferase reporter assay, Western blot	19703993
MIRT001175	hsa-miR-200a-3p	Luciferase reporter assay	19703993
MIRT001175	hsa-miR-200a-3p	Luciferase reporter assay, qRT-PCR, Western blot	19931509
MIRT001557	hsa-miR-155-5p	pSILAC	18668040
MIRT007031	hsa-miR-214-3p	Luciferase reporter assay	23068095
MIRT001175	hsa-miR-200a-3p	Reporter assay;Western blot;qRT-PCR	19931509
MIRT001557	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT022723	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT024185	hsa-miR-221-3p	Sequencing	20371350
MIRT025403	hsa-miR-34a-5p	Proteomics	21566225
MIRT025403	hsa-miR-34a-5p	Proteomics	21566225
MIRT028521	hsa-miR-30a-5p	Proteomics	18668040
MIRT043472	hsa-miR-331-3p	CLASH	23622248
MIRT037926	hsa-miR-532-3p	CLASH	23622248
MIRT037700	hsa-miR-744-5p	CLASH	23622248
MIRT036496	hsa-miR-1226-3p	CLASH	23622248
MIRT001175	hsa-miR-200a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22211245
MIRT001175	hsa-miR-200a-3p	Flow, Luciferase reporter assay, Western blot	22211245
MIRT053427	hsa-miR-512-5p	Microarray	23807165
MIRT053731	hsa-miR-624-3p	Microarray	22942087
MIRT007031	hsa-miR-214-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22962603
MIRT054050	hsa-miR-34a-3p	Luciferase reporter assay, Western blot	22421157
MIRT054050	hsa-miR-34a-3p	Luciferase reporter assay, Western blot	22421157
MIRT054051	hsa-miR-34b-5p	Luciferase reporter assay, Western blot	22421157
MIRT054051	hsa-miR-34b-5p	Luciferase reporter assay, Western blot	22421157
MIRT054052	hsa-miR-34c-3p	Luciferase reporter assay, Western blot	22421157
MIRT054052	hsa-miR-34c-3p	Luciferase reporter assay, Western blot	22421157
MIRT307297	hsa-miR-548l	HITS-CLIP	23313552
MIRT704447	hsa-miR-875-5p	HITS-CLIP	23313552
MIRT704446	hsa-miR-3973	HITS-CLIP	23313552
MIRT704445	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT704444	hsa-miR-520h	HITS-CLIP	23313552
MIRT704443	hsa-miR-3688-5p	HITS-CLIP	23313552
MIRT704442	hsa-miR-891a-3p	HITS-CLIP	23313552
MIRT704441	hsa-miR-3144-3p	HITS-CLIP	23313552
MIRT704440	hsa-miR-7108-5p	HITS-CLIP	23313552
MIRT704439	hsa-miR-4474-3p	HITS-CLIP	23313552
MIRT704438	hsa-miR-607	HITS-CLIP	23313552
MIRT704437	hsa-miR-2113	HITS-CLIP	23313552
MIRT704436	hsa-miR-5010-3p	HITS-CLIP	23313552
MIRT524299	hsa-miR-142-3p	PAR-CLIP	20371350
MIRT307327	hsa-miR-7849-3p	PAR-CLIP	20371350
MIRT091934	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT091935	hsa-miR-8062	PAR-CLIP	20371350
MIRT209910	hsa-miR-4255	PAR-CLIP	20371350
MIRT091932	hsa-miR-4765	PAR-CLIP	20371350
MIRT091926	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT091931	hsa-miR-3591-5p	PAR-CLIP	20371350
MIRT524299	hsa-miR-142-3p	PAR-CLIP	20371350
MIRT091934	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT091935	hsa-miR-8062	PAR-CLIP	20371350
MIRT209910	hsa-miR-4255	PAR-CLIP	20371350
MIRT091932	hsa-miR-4765	PAR-CLIP	20371350
MIRT091926	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT091931	hsa-miR-3591-5p	PAR-CLIP	20371350
MIRT524299	hsa-miR-142-3p	PAR-CLIP	23446348
MIRT091934	hsa-miR-5586-3p	PAR-CLIP	23446348
MIRT091935	hsa-miR-8062	PAR-CLIP	23446348
MIRT209910	hsa-miR-4255	PAR-CLIP	23446348
MIRT091932	hsa-miR-4765	PAR-CLIP	23446348
MIRT091931	hsa-miR-3591-5p	PAR-CLIP	23446348
MIRT001175	hsa-miR-200a-3p	Luciferase reporter assay	26878281
MIRT001175	hsa-miR-200a-3p	Luciferase reporter assay	26878281
MIRT731452	hsa-miR-370-3p	Luciferase reporter assay	27138069
MIRT731452	hsa-miR-370-3p	Luciferase reporter assay	27138069
MIRT732085	hsa-miR-375	Luciferase reporter assay	28158288
MIRT732085	hsa-miR-375	Luciferase reporter assay	28158288
MIRT732180	hsa-miR-3162-3p	Luciferase reporter assay, qRT-PCR, Western blot	26959414
MIRT732180	hsa-miR-3162-3p	Luciferase reporter assay, qRT-PCR, Western blot	26959414
MIRT732180	hsa-miR-3162-3p	Luciferase reporter assay, qRT-PCR, Western blot	26959414
MIRT732180	hsa-miR-3162-3p	Luciferase reporter assay, qRT-PCR, Western blot	26959414
MIRT755393	hsa-miR-181a-5p	Luciferase reporter assay, Western blot	28086904
MIRT755393	hsa-miR-181a-5p	Luciferase reporter assay, Western blot	28086904
MIRT001175	hsa-miR-200a-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28302418
MIRT001175	hsa-miR-200a-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28302418
MIRT001175	hsa-miR-200a-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28302418
MIRT001175	hsa-miR-200a-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28302418
MIRT007031	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR, Western blot	26807179
MIRT025403	hsa-miR-34a-5p	qRT-PCR, Western blotting	33740991
MIRT524299	hsa-miR-142-3p	Immunocytochemistry (ICC), Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	33643894
MIRT735887	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735887	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735887	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, In situ hybridization	32641995
MIRT736768	hsa-miR-496	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR, In situ hybridization	32318572
MIRT524299	hsa-miR-142-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32983253
MIRT307297	hsa-miR-548l	HITS-CLIP	23313552
MIRT704447	hsa-miR-875-5p	HITS-CLIP	23313552
MIRT704446	hsa-miR-3973	HITS-CLIP	23313552
MIRT704445	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT704444	hsa-miR-520h	HITS-CLIP	23313552
MIRT704443	hsa-miR-3688-5p	HITS-CLIP	23313552
MIRT704442	hsa-miR-891a-3p	HITS-CLIP	23313552
MIRT704441	hsa-miR-3144-3p	HITS-CLIP	23313552
MIRT704440	hsa-miR-7108-5p	HITS-CLIP	23313552
MIRT704439	hsa-miR-4474-3p	HITS-CLIP	23313552
MIRT704438	hsa-miR-607	HITS-CLIP	23313552
MIRT704437	hsa-miR-2113	HITS-CLIP	23313552
MIRT704436	hsa-miR-5010-3p	HITS-CLIP	23313552
MIRT524299	hsa-miR-142-3p	PAR-CLIP	20371350
MIRT307327	hsa-miR-7849-3p	PAR-CLIP	20371350
MIRT091934	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT091935	hsa-miR-8062	PAR-CLIP	20371350
MIRT209910	hsa-miR-4255	PAR-CLIP	20371350
MIRT091932	hsa-miR-4765	PAR-CLIP	20371350
MIRT091926	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT091931	hsa-miR-3591-5p	PAR-CLIP	20371350
MIRT524299	hsa-miR-142-3p	PAR-CLIP	20371350
MIRT091934	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT091935	hsa-miR-8062	PAR-CLIP	20371350
MIRT209910	hsa-miR-4255	PAR-CLIP	20371350
MIRT091932	hsa-miR-4765	PAR-CLIP	20371350
MIRT091926	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT091931	hsa-miR-3591-5p	PAR-CLIP	20371350
MIRT524299	hsa-miR-142-3p	PAR-CLIP	23446348
MIRT091934	hsa-miR-5586-3p	PAR-CLIP	23446348
MIRT091935	hsa-miR-8062	PAR-CLIP	23446348
MIRT209910	hsa-miR-4255	PAR-CLIP	23446348
MIRT091932	hsa-miR-4765	PAR-CLIP	23446348
MIRT091931	hsa-miR-3591-5p	PAR-CLIP	23446348
MIRT755393	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Immunofluorescence	35336965
MIRT756433	hsa-miR-146a-5p	qRT-PCR	36415628
MIRT914938	hsa-miR-1233	CLIP-seq
MIRT914939	hsa-miR-1324	CLIP-seq
MIRT914940	hsa-miR-1972	CLIP-seq
MIRT914941	hsa-miR-3129-3p	CLIP-seq
MIRT914942	hsa-miR-3619-3p	CLIP-seq
MIRT914943	hsa-miR-3682-5p	CLIP-seq
MIRT914944	hsa-miR-4251	CLIP-seq
MIRT914945	hsa-miR-4303	CLIP-seq
MIRT914946	hsa-miR-4329	CLIP-seq
MIRT914947	hsa-miR-4438	CLIP-seq
MIRT914948	hsa-miR-4453	CLIP-seq
MIRT914949	hsa-miR-4490	CLIP-seq
MIRT914950	hsa-miR-4496	CLIP-seq
MIRT914951	hsa-miR-4503	CLIP-seq
MIRT914952	hsa-miR-4535	CLIP-seq
MIRT914953	hsa-miR-4538	CLIP-seq
MIRT914954	hsa-miR-4687-5p	CLIP-seq
MIRT914955	hsa-miR-4690-3p	CLIP-seq
MIRT914956	hsa-miR-4705	CLIP-seq
MIRT914957	hsa-miR-4762-3p	CLIP-seq
MIRT914958	hsa-miR-4776-5p	CLIP-seq
MIRT914959	hsa-miR-5095	CLIP-seq
MIRT914960	hsa-miR-545	CLIP-seq
MIRT914961	hsa-miR-548an	CLIP-seq
MIRT914962	hsa-miR-548g	CLIP-seq
MIRT914963	hsa-miR-582-3p	CLIP-seq
MIRT914964	hsa-miR-618	CLIP-seq
MIRT914965	hsa-miR-624	CLIP-seq
MIRT914966	hsa-miR-634	CLIP-seq
MIRT914967	hsa-miR-127-5p	CLIP-seq
MIRT914968	hsa-miR-1276	CLIP-seq
MIRT914969	hsa-miR-141	CLIP-seq
MIRT914970	hsa-miR-200a	CLIP-seq
MIRT914971	hsa-miR-214	CLIP-seq
MIRT914972	hsa-miR-300	CLIP-seq
MIRT914973	hsa-miR-302f	CLIP-seq
MIRT914974	hsa-miR-3122	CLIP-seq
MIRT914975	hsa-miR-3137	CLIP-seq
MIRT914976	hsa-miR-3161	CLIP-seq
MIRT914977	hsa-miR-330-3p	CLIP-seq
MIRT914978	hsa-miR-3619-5p	CLIP-seq
MIRT914979	hsa-miR-381	CLIP-seq
MIRT914980	hsa-miR-3913-5p	CLIP-seq
MIRT914981	hsa-miR-3942-3p	CLIP-seq
MIRT914982	hsa-miR-4274	CLIP-seq
MIRT914983	hsa-miR-4282	CLIP-seq
MIRT914949	hsa-miR-4490	CLIP-seq
MIRT914984	hsa-miR-450b-3p	CLIP-seq
MIRT914985	hsa-miR-4519	CLIP-seq
MIRT914986	hsa-miR-4539	CLIP-seq
MIRT914987	hsa-miR-4635	CLIP-seq
MIRT914988	hsa-miR-4666-3p	CLIP-seq
MIRT914989	hsa-miR-4718	CLIP-seq
MIRT914990	hsa-miR-4731-3p	CLIP-seq
MIRT914991	hsa-miR-4753-3p	CLIP-seq
MIRT914992	hsa-miR-4768-5p	CLIP-seq
MIRT914993	hsa-miR-4789-5p	CLIP-seq
MIRT914994	hsa-miR-4796-5p	CLIP-seq
MIRT914995	hsa-miR-4801	CLIP-seq
MIRT914961	hsa-miR-548an	CLIP-seq
MIRT914962	hsa-miR-548g	CLIP-seq
MIRT914996	hsa-miR-548n	CLIP-seq
MIRT914997	hsa-miR-548t	CLIP-seq
MIRT914998	hsa-miR-561	CLIP-seq
MIRT914999	hsa-miR-578	CLIP-seq
MIRT915000	hsa-miR-581	CLIP-seq
MIRT914963	hsa-miR-582-3p	CLIP-seq
MIRT915001	hsa-miR-640	CLIP-seq
MIRT915002	hsa-miR-657	CLIP-seq
MIRT915003	hsa-miR-761	CLIP-seq
MIRT915004	hsa-miR-769-3p	CLIP-seq
MIRT915005	hsa-miR-888	CLIP-seq
MIRT914967	hsa-miR-127-5p	CLIP-seq
MIRT914969	hsa-miR-141	CLIP-seq
MIRT1971412	hsa-miR-150	CLIP-seq
MIRT914970	hsa-miR-200a	CLIP-seq
MIRT914971	hsa-miR-214	CLIP-seq
MIRT914973	hsa-miR-302f	CLIP-seq
MIRT914975	hsa-miR-3137	CLIP-seq
MIRT1971413	hsa-miR-3149	CLIP-seq
MIRT914977	hsa-miR-330-3p	CLIP-seq
MIRT914978	hsa-miR-3619-5p	CLIP-seq
MIRT914982	hsa-miR-4274	CLIP-seq
MIRT914985	hsa-miR-4519	CLIP-seq
MIRT914987	hsa-miR-4635	CLIP-seq
MIRT1971414	hsa-miR-4668-3p	CLIP-seq
MIRT914989	hsa-miR-4718	CLIP-seq
MIRT914991	hsa-miR-4753-3p	CLIP-seq
MIRT1971415	hsa-miR-483-3p	CLIP-seq
MIRT1971416	hsa-miR-526b	CLIP-seq
MIRT915000	hsa-miR-581	CLIP-seq
MIRT1971417	hsa-miR-627	CLIP-seq
MIRT915002	hsa-miR-657	CLIP-seq
MIRT1971418	hsa-miR-668	CLIP-seq
MIRT915003	hsa-miR-761	CLIP-seq
MIRT914938	hsa-miR-1233	CLIP-seq
MIRT914967	hsa-miR-127-5p	CLIP-seq
MIRT914939	hsa-miR-1324	CLIP-seq
MIRT914969	hsa-miR-141	CLIP-seq
MIRT914940	hsa-miR-1972	CLIP-seq
MIRT914970	hsa-miR-200a	CLIP-seq
MIRT914971	hsa-miR-214	CLIP-seq
MIRT914974	hsa-miR-3122	CLIP-seq
MIRT1971413	hsa-miR-3149	CLIP-seq
MIRT914977	hsa-miR-330-3p	CLIP-seq
MIRT2207001	hsa-miR-3591-3p	CLIP-seq
MIRT914978	hsa-miR-3619-5p	CLIP-seq
MIRT914980	hsa-miR-3913-5p	CLIP-seq
MIRT914981	hsa-miR-3942-3p	CLIP-seq
MIRT2207002	hsa-miR-412	CLIP-seq
MIRT914947	hsa-miR-4438	CLIP-seq
MIRT914949	hsa-miR-4490	CLIP-seq
MIRT2207003	hsa-miR-4509	CLIP-seq
MIRT914984	hsa-miR-450b-3p	CLIP-seq
MIRT914987	hsa-miR-4635	CLIP-seq
MIRT914954	hsa-miR-4687-5p	CLIP-seq
MIRT914955	hsa-miR-4690-3p	CLIP-seq
MIRT914956	hsa-miR-4705	CLIP-seq
MIRT914991	hsa-miR-4753-3p	CLIP-seq
MIRT914992	hsa-miR-4768-5p	CLIP-seq
MIRT914959	hsa-miR-5095	CLIP-seq
MIRT1971416	hsa-miR-526b	CLIP-seq
MIRT914960	hsa-miR-545	CLIP-seq
MIRT914961	hsa-miR-548an	CLIP-seq
MIRT914962	hsa-miR-548g	CLIP-seq
MIRT2207004	hsa-miR-550b	CLIP-seq
MIRT915000	hsa-miR-581	CLIP-seq
MIRT914963	hsa-miR-582-3p	CLIP-seq
MIRT914964	hsa-miR-618	CLIP-seq
MIRT1971417	hsa-miR-627	CLIP-seq
MIRT914966	hsa-miR-634	CLIP-seq
MIRT915002	hsa-miR-657	CLIP-seq
MIRT2207005	hsa-miR-660	CLIP-seq
MIRT915003	hsa-miR-761	CLIP-seq
MIRT915004	hsa-miR-769-3p	CLIP-seq
MIRT1971412	hsa-miR-150	CLIP-seq
MIRT914972	hsa-miR-300	CLIP-seq
MIRT914979	hsa-miR-381	CLIP-seq
MIRT914981	hsa-miR-3942-3p	CLIP-seq
MIRT2207002	hsa-miR-412	CLIP-seq
MIRT914988	hsa-miR-4666-3p	CLIP-seq
MIRT1971414	hsa-miR-4668-3p	CLIP-seq
MIRT914990	hsa-miR-4731-3p	CLIP-seq
MIRT914993	hsa-miR-4789-5p	CLIP-seq
MIRT914994	hsa-miR-4796-5p	CLIP-seq
MIRT914995	hsa-miR-4801	CLIP-seq
MIRT1971415	hsa-miR-483-3p	CLIP-seq
MIRT1971416	hsa-miR-526b	CLIP-seq
MIRT914999	hsa-miR-578	CLIP-seq
MIRT915000	hsa-miR-581	CLIP-seq
MIRT1971417	hsa-miR-627	CLIP-seq
MIRT915001	hsa-miR-640	CLIP-seq
MIRT1971418	hsa-miR-668	CLIP-seq
MIRT915000	hsa-miR-581	CLIP-seq
MIRT914944	hsa-miR-4251	CLIP-seq
MIRT914945	hsa-miR-4303	CLIP-seq
MIRT914946	hsa-miR-4329	CLIP-seq
MIRT914955	hsa-miR-4690-3p	CLIP-seq
MIRT914957	hsa-miR-4762-3p	CLIP-seq
MIRT914966	hsa-miR-634	CLIP-seq
MIRT914972	hsa-miR-300	CLIP-seq
MIRT2510204	hsa-miR-3121-3p	CLIP-seq
MIRT914941	hsa-miR-3129-3p	CLIP-seq
MIRT2207001	hsa-miR-3591-3p	CLIP-seq
MIRT2510205	hsa-miR-3613-3p	CLIP-seq
MIRT914942	hsa-miR-3619-3p	CLIP-seq
MIRT914979	hsa-miR-381	CLIP-seq
MIRT914950	hsa-miR-4496	CLIP-seq
MIRT914951	hsa-miR-4503	CLIP-seq
MIRT914952	hsa-miR-4535	CLIP-seq
MIRT914988	hsa-miR-4666-3p	CLIP-seq
MIRT914990	hsa-miR-4731-3p	CLIP-seq
MIRT2510206	hsa-miR-4733-5p	CLIP-seq
MIRT914958	hsa-miR-4776-5p	CLIP-seq
MIRT914993	hsa-miR-4789-5p	CLIP-seq
MIRT914994	hsa-miR-4796-5p	CLIP-seq
MIRT914995	hsa-miR-4801	CLIP-seq
MIRT2207004	hsa-miR-550b	CLIP-seq
MIRT2207005	hsa-miR-660	CLIP-seq
MIRT2510204	hsa-miR-3121-3p	CLIP-seq
MIRT914941	hsa-miR-3129-3p	CLIP-seq
MIRT2207001	hsa-miR-3591-3p	CLIP-seq
MIRT2510205	hsa-miR-3613-3p	CLIP-seq
MIRT914942	hsa-miR-3619-3p	CLIP-seq
MIRT914950	hsa-miR-4496	CLIP-seq
MIRT914951	hsa-miR-4503	CLIP-seq
MIRT914952	hsa-miR-4535	CLIP-seq
MIRT2510206	hsa-miR-4733-5p	CLIP-seq
MIRT914958	hsa-miR-4776-5p	CLIP-seq
MIRT914994	hsa-miR-4796-5p	CLIP-seq
MIRT2207004	hsa-miR-550b	CLIP-seq
MIRT2207005	hsa-miR-660	CLIP-seq

Transcription factors

Show/Hide all(10)

Transcription factor	Regulation	Reference
AR	Activation	18535113
ESR1	Repression	16628468
LEF1	Unknown	11326276
NELFCD	Repression	20735431
NKX2-5	Unknown	19479054
SIRT1	Repression	22245592
SOX6	Repression	21084391
TCF7L2	Unknown	24317174
TP53	Repression	19411072
ZNF24	Activation	24224020

Show/Hide all(128)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	29374064
GO:0000791	Component	Euchromatin	IDA	22723415
GO:0000922	Component	Spindle pole	IEA
GO:0001085	Function	RNA polymerase II transcription factor binding	IDA	12651860, 18193033, 18579517
GO:0001085	Function	RNA polymerase II transcription factor binding	IPI	18936100
GO:0001102	Function	RNA polymerase II activating transcription factor binding	IPI	19443654
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IC	20123964
GO:0001837	Process	Epithelial to mesenchymal transition	TAS	14679171
GO:0002052	Process	Positive regulation of neuroblast proliferation	ISS
GO:0003682	Function	Chromatin binding	ISS
GO:0003713	Function	Transcription coactivator activity	IBA	21873635
GO:0003713	Function	Transcription coactivator activity	IDA	9065402, 11751639, 12651860, 18193033
GO:0003713	Function	Transcription coactivator activity	IMP	12949260
GO:0005515	Function	Protein binding	IPI	7890674, 8638126, 9264463, 9601641, 9632714, 9707618, 10706604, 10773885, 10801826, 10825188, 10987273, 11401320, 11533658, 11590244, 11713475, 11713476, 11955446, 12297051, 12370829, 12408824, 12421363, 12820959, 12927518, 14595118, 14600025, 15110721, 15327768, 15327769, 15843474
GO:0005634	Component	Nucleus	IDA	9707618, 10980594, 15040835, 16858403, 18193033, 18756595, 18787224, 19095296, 19187541, 28829046, 29367600, 29739711
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	11751639
GO:0005737	Component	Cytoplasm	IDA	7806582, 9707618, 11793365, 12138115, 12937339, 12970740, 18787224, 19095296, 19591802, 22467863, 29739711
GO:0005813	Component	Centrosome	IDA	18086858, 20300119
GO:0005829	Component	Cytosol	IDA	10980594, 19187541
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	12138115, 12970740
GO:0005911	Component	Cell-cell junction	IDA	19151727, 19996314
GO:0005912	Component	Adherens junction	IBA	21873635
GO:0005912	Component	Adherens junction	IDA	10403777, 18086858, 19101069, 20086044, 22855531
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005938	Component	Cell cortex	IDA	19038973
GO:0007155	Process	Cell adhesion	IMP	19101069
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	TAS
GO:0008013	Function	Beta-catenin binding	IPI	29739711
GO:0008022	Function	Protein C-terminus binding	IPI	10773885, 15843474
GO:0008134	Function	Transcription factor binding	IPI	15905404, 20123964
GO:0008134	Function	Transcription factor binding	TAS	16344550
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	12970740
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IGI	23983127
GO:0010909	Process	Positive regulation of heparan sulfate proteoglycan biosynthetic process	IMP	15853773
GO:0016020	Component	Membrane	ISS
GO:0016032	Process	Viral process	IEA
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0016323	Component	Basolateral plasma membrane	IDA	24862762
GO:0016328	Component	Lateral plasma membrane	IDA	12072559, 22855531
GO:0016342	Component	Catenin complex	IBA	21873635
GO:0016342	Component	Catenin complex	IDA	7650039, 18593713, 20302655, 28051089
GO:0016525	Process	Negative regulation of angiogenesis	ISS
GO:0019827	Process	Stem cell population maintenance	TAS	22723415
GO:0019899	Function	Enzyme binding	IPI	11533658, 18356165, 21724833
GO:0019900	Function	Kinase binding	IPI	8638126
GO:0019903	Function	Protein phosphatase binding	IBA	21873635
GO:0019903	Function	Protein phosphatase binding	IPI	8663237, 16574648
GO:0030054	Component	Cell junction	IDA	19038973, 20412773
GO:0030054	Component	Cell junction	TAS	17047063
GO:0030331	Function	Estrogen receptor binding	IPI	15304487
GO:0030877	Component	Beta-catenin destruction complex	IDA	8638126, 16188939
GO:0030997	Process	Regulation of centriole-centriole cohesion	IDA	18086858
GO:0032355	Process	Response to estradiol	IDA	15304487
GO:0032481	Process	Positive regulation of type I interferon production	TAS
GO:0032991	Component	Protein-containing complex	IDA	22083958
GO:0032993	Component	Protein-DNA complex	IDA	10825188
GO:0033234	Process	Negative regulation of protein sumoylation	IDA	22155184
GO:0034333	Process	Adherens junction assembly	IMP	20086044, 20123964
GO:0034394	Process	Protein localization to cell surface	IMP	20086044
GO:0035257	Function	Nuclear hormone receptor binding	IBA	21873635
GO:0035257	Function	Nuclear hormone receptor binding	IPI	12799378
GO:0035257	Function	Nuclear hormone receptor binding	TAS	16344550
GO:0035315	Process	Hair cell differentiation	TAS	19251162
GO:0035635	Process	Entry of bacterium into host cell	TAS
GO:0035995	Process	Detection of muscle stretch	TAS	30568254
GO:0036023	Process	Embryonic skeletal limb joint morphogenesis	ISS
GO:0042493	Process	Response to drug	IEP	18291362
GO:0042995	Component	Cell projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	12651860, 12970740
GO:0043066	Process	Negative regulation of apoptotic process	IMP	12154096
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	29374064
GO:0043525	Process	Positive regulation of neuron apoptotic process	IDA	19591802
GO:0044325	Function	Ion channel binding	IPI	19996314
GO:0044334	Process	Canonical Wnt signaling pathway involved in positive regulation of epithelial to mesenchymal transition	IMP	17072303
GO:0044336	Process	Canonical Wnt signaling pathway involved in negative regulation of apoptotic process	TAS	23164821
GO:0045202	Component	Synapse	ISS
GO:0045294	Function	Alpha-catenin binding	IBA	21873635
GO:0045294	Function	Alpha-catenin binding	IPI	7650039, 7890674, 23136403
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045296	Function	Cadherin binding	IBA	21873635
GO:0045296	Function	Cadherin binding	IPI	12734196, 18287330, 19038973
GO:0045765	Process	Regulation of angiogenesis	TAS	18756595
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IMP	19653274
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	12970740, 18787224
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	12949260
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9065402, 11751639, 12651860, 14660579, 18193033
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	15592430, 19328798, 22723415
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	24115276, 24431302
GO:0045976	Process	Negative regulation of mitotic cell cycle, embryonic	ISS
GO:0046332	Function	SMAD binding	IPI	18593713
GO:0048145	Process	Regulation of fibroblast proliferation	TAS	16858403
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	19038973
GO:0048660	Process	Regulation of smooth muscle cell proliferation	IMP	17122440
GO:0050767	Process	Regulation of neurogenesis	TAS	24431302
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	15905404
GO:0051149	Process	Positive regulation of muscle cell differentiation	TAS
GO:0051571	Process	Positive regulation of histone H3-K4 methylation	IC	22723415
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	10644691, 12937339, 19187541
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	12154096, 18193033
GO:0060828	Process	Regulation of canonical Wnt signaling pathway	TAS
GO:0061154	Process	Endothelial tube morphogenesis	IMP	20123964
GO:0061324	Process	Canonical Wnt signaling pathway involved in positive regulation of cardiac outflow tract cell proliferation	ISS
GO:0061549	Process	Sympathetic ganglion development	ISS
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070369	Component	Beta-catenin-TCF7L2 complex	IDA	9065401, 9065402, 12651860
GO:0070411	Function	I-SMAD binding	IPI	18593713
GO:0070602	Process	Regulation of centromeric sister chromatid cohesion	IMP	20300119
GO:0071363	Process	Cellular response to growth factor stimulus	IMP	16858403
GO:0071681	Process	Cellular response to indole-3-methanol	IDA	10868478
GO:0071944	Component	Cell periphery	IDA	19038973
GO:0072182	Process	Regulation of nephron tubule epithelial cell differentiation	ISS
GO:0090279	Process	Regulation of calcium ion import	IDA	19996314
GO:0098609	Process	Cell-cell adhesion	IMP	18593713
GO:1904798	Process	Positive regulation of core promoter binding	IDA	22723415
GO:1904837	Process	Beta-catenin-TCF complex assembly	TAS
GO:1904886	Process	Beta-catenin destruction complex disassembly	TAS
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	ISS
GO:1904954	Process	Canonical Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation	IC
GO:1990138	Process	Neuron projection extension	IMP	19830702
GO:1990907	Component	Beta-catenin-TCF complex	IDA	28296634
GO:1990907	Component	Beta-catenin-TCF complex	IPI	11955446, 18936100
GO:1990909	Component	Wnt signalosome	NAS	24115276
GO:2000008	Process	Regulation of protein localization to cell surface	IDA	19996314
GO:2000144	Process	Positive regulation of DNA-templated transcription, initiation	IC	22723415

MIM	HGNC	e!Ensembl
116806	2514	ENSG00000168036

Protein

UniProt ID

P35222

Protein name

Catenin beta-1 (Beta-catenin)

Protein function

Key downstream component of the canonical Wnt signaling pathway (PubMed:17524503, PubMed:18077326, PubMed:18086858, PubMed:18957423, PubMed:21262353, PubMed:22155184, PubMed:22647378, PubMed:22699938). In the absence of Wnt, forms a complex with

PDB

1G3J , 1JDH , 1JPW , 1LUJ , 1P22 , 1QZ7 , 1T08 , 1TH1 , 2G57 , 2GL7 , 2Z6H , 3DIW , 3FQN , 3FQR , 3SL9 , 3SLA , 3TX7 , 4DJS , 6M90 , 6M91 , 6M92 , 6M93 , 6M94 , 6O9B , 6O9C , 6WLX , 6WNX , 7AFW , 7AR4 , 7UWI , 7UWO , 7ZRB , 8EI9 , 8EIA , 8EIB , 8EIC , 8RU3 , 8RU4 , 8VME , 8VMF , 8Y0G , 8Y0P , 8Y14 , 8Z0U , 8Z10 , 8Z5J , 8Z61

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00514	Arm	224 → 263	Armadillo/beta-catenin-like repeat	Repeat
PF00514	Arm	350 → 390	Armadillo/beta-catenin-like repeat	Repeat
PF00514	Arm	431 → 473	Armadillo/beta-catenin-like repeat	Repeat
PF00514	Arm	583 → 623	Armadillo/beta-catenin-like repeat	Repeat

Sequence

MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L

Sequence length

781

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412