CREB3 (cAMP responsive element binding protein 3)

Gene

• Entrez ID: 10488
• Gene name: CAMP responsive element binding protein 3
• Gene symbol: CREB3
• Synonyms: LUMAN, LZIP, sLZIP
• Chromosome: 9
• Chromosome location: 9p13.3
• Summary: This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also as

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019911	hsa-miR-375	Microarray	20215506
MIRT908625	hsa-miR-1976	CLIP-seq
MIRT908626	hsa-miR-3155	CLIP-seq
MIRT908627	hsa-miR-3155b	CLIP-seq
MIRT908628	hsa-miR-370	CLIP-seq
MIRT908629	hsa-miR-4329	CLIP-seq
MIRT908630	hsa-miR-4663	CLIP-seq
MIRT908631	hsa-miR-4786-5p	CLIP-seq
MIRT908632	hsa-miR-484	CLIP-seq
MIRT908633	hsa-miR-769-5p	CLIP-seq
MIRT1969290	hsa-miR-4520a-3p	CLIP-seq
MIRT1969291	hsa-miR-4520b-3p	CLIP-seq
MIRT1969292	hsa-miR-4529-3p	CLIP-seq
MIRT2205353	hsa-miR-28-5p	CLIP-seq
MIRT2205354	hsa-miR-3139	CLIP-seq
MIRT2205355	hsa-miR-558	CLIP-seq
MIRT2205356	hsa-miR-708	CLIP-seq
MIRT2447593	hsa-miR-1225-5p	CLIP-seq
MIRT2447594	hsa-miR-1912	CLIP-seq
MIRT2447595	hsa-miR-3667-5p	CLIP-seq
MIRT2447596	hsa-miR-4643	CLIP-seq
MIRT2447597	hsa-miR-4717-3p	CLIP-seq
MIRT2447598	hsa-miR-642b	CLIP-seq
MIRT2508657	hsa-miR-1225-3p	CLIP-seq
MIRT2447593	hsa-miR-1225-5p	CLIP-seq
MIRT2508658	hsa-miR-1233	CLIP-seq
MIRT2508659	hsa-miR-1280	CLIP-seq
MIRT2508660	hsa-miR-129-3p	CLIP-seq
MIRT2447594	hsa-miR-1912	CLIP-seq
MIRT2205353	hsa-miR-28-5p	CLIP-seq
MIRT2205354	hsa-miR-3139	CLIP-seq
MIRT2508661	hsa-miR-3194-5p	CLIP-seq
MIRT2508662	hsa-miR-3650	CLIP-seq
MIRT2508663	hsa-miR-3660	CLIP-seq
MIRT2447595	hsa-miR-3667-5p	CLIP-seq
MIRT2508664	hsa-miR-4264	CLIP-seq
MIRT2508665	hsa-miR-4526	CLIP-seq
MIRT2447596	hsa-miR-4643	CLIP-seq
MIRT2508666	hsa-miR-4687-5p	CLIP-seq
MIRT2447597	hsa-miR-4717-3p	CLIP-seq
MIRT2205355	hsa-miR-558	CLIP-seq
MIRT2508667	hsa-miR-595	CLIP-seq
MIRT2447598	hsa-miR-642b	CLIP-seq
MIRT2205356	hsa-miR-708	CLIP-seq
MIRT2508657	hsa-miR-1225-3p	CLIP-seq
MIRT2447593	hsa-miR-1225-5p	CLIP-seq
MIRT2508658	hsa-miR-1233	CLIP-seq
MIRT2508659	hsa-miR-1280	CLIP-seq
MIRT2508660	hsa-miR-129-3p	CLIP-seq
MIRT2447594	hsa-miR-1912	CLIP-seq
MIRT2205353	hsa-miR-28-5p	CLIP-seq
MIRT2205354	hsa-miR-3139	CLIP-seq
MIRT2508661	hsa-miR-3194-5p	CLIP-seq
MIRT2508662	hsa-miR-3650	CLIP-seq
MIRT2508663	hsa-miR-3660	CLIP-seq
MIRT2447595	hsa-miR-3667-5p	CLIP-seq
MIRT2508664	hsa-miR-4264	CLIP-seq
MIRT1969291	hsa-miR-4520b-3p	CLIP-seq
MIRT2508665	hsa-miR-4526	CLIP-seq
MIRT1969292	hsa-miR-4529-3p	CLIP-seq
MIRT2447596	hsa-miR-4643	CLIP-seq
MIRT2508666	hsa-miR-4687-5p	CLIP-seq
MIRT2447597	hsa-miR-4717-3p	CLIP-seq
MIRT2205355	hsa-miR-558	CLIP-seq
MIRT2508667	hsa-miR-595	CLIP-seq
MIRT2447598	hsa-miR-642b	CLIP-seq
MIRT2205356	hsa-miR-708	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	17296613
RELA	Unknown	17296613

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	16940180
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16940180
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	16940180
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	16940180
GO:0005515	Function	Protein binding	IPI	10629049, 10871379, 15705566, 17483474, 18391022, 20102225, 20195357, 21516116, 29547901, 31515488
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IC	16940180
GO:0005634	Component	Nucleus	IDA	20546900
GO:0005654	Component	Nucleoplasm	TAS
GO:0005783	Component	Endoplasmic reticulum	IDA	16236796
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006935	Process	Chemotaxis	IEA
GO:0006990	Process	Positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response	IDA	16940180
GO:0016021	Component	Integral component of membrane	IEA
GO:0016032	Process	Viral process	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	TAS
GO:0035497	Function	CAMP response element binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16940180, 17296613
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16940180
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	17296613
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	16940180
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 606443
• HGNC: 2347
• e!Ensembl: ENSG00000107175

Protein

• UniProt ID: O43889
• Protein name: Cyclic AMP-responsive element-binding protein 3 (CREB-3) (cAMP-responsive element-binding protein 3) (Leucine zipper protein) (Luman) (Transcription factor LZIP-alpha) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3 (N-terminal Lu
• Protein function: Endoplasmic reticulum (ER)-bound sequence-specific transcription factor that directly binds DNA and activates transcription (PubMed:10984507, PubMed:15845366, PubMed:16940180, PubMed:19779205, PubMed:9271389). Plays a role in the unfolded protei
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00170	bZIP_1	148 → 211	bZIP transcription factor	Coiled-coil

• Sequence:

  MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSP
  PASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARL
  VLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLES
  RVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCL
  LLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC
  VLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGS
  PSVILQDRYSG

• Sequence length: 371