GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

CREB1 (cAMP responsive element binding protein 1)

Gene

1385

CAMP responsive element binding protein 1

CREB1

CREB, CREB-1

2q33.3

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016]

Show/Hide all(134)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000066	hsa-miR-34b-5p	Luciferase reporter assay, qRT-PCR, Western blot	19258499
MIRT000066	hsa-miR-34b-5p	Luciferase reporter assay	19461653
MIRT004766	hsa-miR-103a-3p	Luciferase reporter assay, qRT-PCR, Western blot	20886090
MIRT006273	hsa-miR-182-5p	GFP reporter assay	22325466
MIRT006496	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR	21707582
MIRT007342	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23543137
MIRT007342	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23546867
MIRT007342	hsa-miR-200b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25825983
MIRT020342	hsa-miR-34b-3p	Microarray, QRTPCR, Western blot	24816316
MIRT023389	hsa-miR-122-5p	Microarray	17612493
MIRT023389	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR, Western blot	28337380
MIRT053489	hsa-miR-181b-5p	GFP reporter assay, qRT-PCR, Western blot	22539488
MIRT053793	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	23185366
MIRT054313	hsa-miR-27b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25825983
MIRT054313	hsa-miR-27b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27809310
MIRT054924	hsa-miR-33b-5p	Luciferase reporter assay, qRT-PCR	23716591
MIRT086927	hsa-miR-6834-5p	PAR-CLIP	22291592
MIRT086929	hsa-miR-433-3p	Luciferase reporter assay	26844702
MIRT119386	hsa-miR-513a-3p	PAR-CLIP	22291592
MIRT119389	hsa-miR-513c-3p	PAR-CLIP	22291592
MIRT119391	hsa-miR-3606-3p	PAR-CLIP	22291592
MIRT205045	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT205045	hsa-miR-17-5p	qRT-PCR	23433743
MIRT205046	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT205047	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT205048	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT205050	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT205053	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT205055	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT205057	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT437867	hsa-miR-19b-3p	qRT-PCR	23433743
MIRT498175	hsa-miR-578	PAR-CLIP	22291592
MIRT498176	hsa-miR-6734-5p	PAR-CLIP	22291592
MIRT498177	hsa-miR-1226-5p	PAR-CLIP	22291592
MIRT498178	hsa-miR-526b-5p	PAR-CLIP	22291592
MIRT498179	hsa-miR-6738-5p	PAR-CLIP	22291592
MIRT498180	hsa-miR-5194	PAR-CLIP	22291592
MIRT498181	hsa-miR-1914-3p	PAR-CLIP	22291592
MIRT498182	hsa-miR-423-5p	PAR-CLIP	22291592
MIRT498183	hsa-miR-3184-5p	PAR-CLIP	22291592
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508596	hsa-miR-1277-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508597	hsa-miR-190a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT508598	hsa-miR-466	PAR-CLIP	23446348
MIRT508598	hsa-miR-466	PAR-CLIP, HITS-CLIP	21572407
MIRT508598	hsa-miR-466	HITS-CLIP	23313552
MIRT508599	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT508599	hsa-miR-656-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT508599	hsa-miR-656-3p	HITS-CLIP	23313552
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508600	hsa-miR-5011-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508601	hsa-miR-4643	PAR-CLIP	23446348
MIRT508601	hsa-miR-4643	PAR-CLIP, HITS-CLIP	21572407
MIRT508601	hsa-miR-4643	HITS-CLIP	23313552
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT508602	hsa-miR-4789-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT508602	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT524344	hsa-miR-8061	PAR-CLIP	23446348
MIRT524345	hsa-miR-4760-5p	PAR-CLIP	23446348
MIRT524346	hsa-miR-297	PAR-CLIP	23446348
MIRT524346	hsa-miR-297	PAR-CLIP, HITS-CLIP	21572407
MIRT524347	hsa-miR-3924	PAR-CLIP	23446348
MIRT524347	hsa-miR-3924	PAR-CLIP, HITS-CLIP	21572407
MIRT524347	hsa-miR-3924	HITS-CLIP	23313552
MIRT524348	hsa-miR-1185-2-3p	PAR-CLIP	23446348
MIRT524349	hsa-miR-1185-1-3p	PAR-CLIP	23446348
MIRT524350	hsa-let-7f-2-3p	PAR-CLIP	23446348
MIRT524351	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT524352	hsa-miR-98-3p	PAR-CLIP	23446348
MIRT524353	hsa-let-7f-1-3p	PAR-CLIP	23446348
MIRT524354	hsa-let-7b-3p	PAR-CLIP	23446348
MIRT524355	hsa-let-7a-3p	PAR-CLIP	23446348
MIRT524356	hsa-miR-376a-5p	PAR-CLIP	23446348
MIRT524357	hsa-miR-567	PAR-CLIP	23446348
MIRT524357	hsa-miR-567	PAR-CLIP, HITS-CLIP	21572407
MIRT524358	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT524359	hsa-miR-381-3p	PAR-CLIP	23446348
MIRT524360	hsa-miR-300	PAR-CLIP	23446348
MIRT524361	hsa-miR-1183	PAR-CLIP	23446348
MIRT524361	hsa-miR-1183	PAR-CLIP, HITS-CLIP	21572407
MIRT524361	hsa-miR-1183	HITS-CLIP	23313552
MIRT524362	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT524363	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT524364	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT524365	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT524366	hsa-miR-5095	PAR-CLIP	23446348
MIRT524367	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT524368	hsa-miR-4252	PAR-CLIP	23446348
MIRT524369	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT524370	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT524371	hsa-miR-519d-5p	PAR-CLIP	23446348
MIRT524371	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT524372	hsa-miR-1273g-3p	PAR-CLIP	23446348
MIRT524373	hsa-miR-520h	PAR-CLIP	23446348
MIRT524374	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT524375	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT524376	hsa-miR-4438	PAR-CLIP	23446348
MIRT524377	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT524378	hsa-miR-520e	PAR-CLIP	23446348
MIRT524379	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT524380	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT524381	hsa-miR-520b	PAR-CLIP	23446348
MIRT524382	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT524383	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT524384	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT524385	hsa-miR-302e	PAR-CLIP	23446348
MIRT524386	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT524387	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT524388	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT524389	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT668900	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT668901	hsa-miR-4263	HITS-CLIP	23824327
MIRT668902	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT668903	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT668904	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT668905	hsa-miR-5696	HITS-CLIP	23824327
MIRT668906	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT668907	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT668908	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT668909	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT668910	hsa-miR-4760-3p	HITS-CLIP	23824327
MIRT668911	hsa-miR-548e-5p	HITS-CLIP	23824327
MIRT668912	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT731575	hsa-miR-204-5p	Luciferase reporter assay	27046651
MIRT732195	hsa-miR-582-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26978739
MIRT732237	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	27285761
MIRT734934	hsa-miR-1224-5p	Luciferase reporter assay	25648114
MIRT735116	hsa-miR-1224-3p	Immunofluorescence	26148557
MIRT735229	hsa-miR-10b-5p	Luciferase reporter assay	26796749
MIRT735230	hsa-miR-363-3p	Luciferase reporter assay	26796749

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
ATF5	Activation	17140605
CREBBP	Activation	19564345
CREM	Repression	11988318
FOXO4	Activation	20136501
SP1	Unknown	17937658
SRF	Repression	1531519

Show/Hide all(81)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IDA	19861239
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	9065434, 19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001102	Function	RNA polymerase II activating transcription factor binding	IPI	19861239
GO:0001225	Function	RNA polymerase II transcription coactivator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19861239
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001666	Process	Response to hypoxia	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	8798441
GO:0005515	Function	Protein binding	IPI	10722738, 14506290, 15964553, 16325578, 16799563, 18160048, 18316612, 20102225, 20159610, 20541704, 20936779, 21172805, 21418524, 21988832, 25609649, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	8798441
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA	21873635
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006468	Process	Protein phosphorylation	IDA	8798441
GO:0007165	Process	Signal transduction	TAS	2974179
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007568	Process	Aging	IEA
GO:0007595	Process	Lactation	IEA
GO:0007613	Process	Memory	IEA
GO:0007623	Process	Circadian rhythm	ISS
GO:0008361	Process	Regulation of cell size	IEA
GO:0008542	Process	Visual learning	IEA
GO:0010033	Process	Response to organic substance	IDA	8798441
GO:0010944	Process	Negative regulation of transcription by competitive promoter binding	IDA	19861239
GO:0014823	Process	Response to activity	IEA
GO:0016032	Process	Viral process	IEA
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0021983	Process	Pituitary gland development	IEA
GO:0030424	Component	Axon	IEA
GO:0030544	Function	Hsp70 protein binding	IEA
GO:0032916	Process	Positive regulation of transforming growth factor beta3 production	IEA
GO:0033363	Process	Secretory granule organization	IEA
GO:0033762	Process	Response to glucagon	ISS
GO:0034670	Process	Chemotaxis to arachidonic acid	IEA
GO:0035035	Function	Histone acetyltransferase binding	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0035497	Function	CAMP response element binding	IBA	21873635
GO:0035497	Function	CAMP response element binding	IDA	19861239
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IEA
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042802	Function	Identical protein binding	IPI	20102225, 25609649
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045672	Process	Positive regulation of osteoclast differentiation	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0045899	Process	Positive regulation of RNA polymerase II transcription preinitiation complex assembly	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	1655749, 8798441, 19861239
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046887	Process	Positive regulation of hormone secretion	IEA
GO:0046889	Process	Positive regulation of lipid biosynthetic process	ISS
GO:0048145	Process	Regulation of fibroblast proliferation	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0055025	Process	Positive regulation of cardiac muscle tissue development	IEA
GO:0060251	Process	Regulation of glial cell proliferation	IEA
GO:0060430	Process	Lung saccule development	IEA
GO:0060509	Process	Type I pneumocyte differentiation	IEA
GO:0071294	Process	Cellular response to zinc ion	IEA
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	IEA
GO:1901215	Process	Negative regulation of neuron death	IEA
GO:1902065	Process	Response to L-glutamate	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990314	Process	Cellular response to insulin-like growth factor stimulus	IEA
GO:1990589	Component	ATF4-CREB1 transcription factor complex	IBA	21873635
GO:1990589	Component	ATF4-CREB1 transcription factor complex	IDA	12871976
GO:1990763	Function	Arrestin family protein binding	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
123810	2345	ENSG00000118260

Protein

UniProt ID

P16220

Protein name

Cyclic AMP-responsive element-binding protein 1 (CREB-1) (cAMP-responsive element-binding protein 1)

Protein function

Phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters. Transcription activation is enhanced by the TORC coactivators which act independently of Ser-119 phosphorylation. Involved in different cellular processes including the synchronization of circadian rhythmicity and the differentiation of adipose cells.

PDB

2LXT , 5ZK1 , 5ZKO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02173	pKID	113 → 153	pKID domain	Family
PF00170	bZIP_1	281 → 340	bZIP transcription factor	Coiled-coil

Sequence

MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD

Sequence length

327

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412