GediPNet logo

CDKN1B (cyclin dependent kinase inhibitor 1B)
Gene
Gene SNPs Transcription factors Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1027
Gene nameGene Name - the full gene name approved by the HGNC.
Cyclin dependent kinase inhibitor 1B
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CDKN1B
SynonymsGene synonyms aliases
CDKN4, KIP1, MEN1B, MEN4, P27KIP1
ChromosomeChromosome number
12
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.1
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4). [provided by RefSeq, Apr 2014]
miRNAmiRNA information provided by mirtarbase database.
Gene SNPs Transcription factors Other IDs
miRTarBase ID miRNA Experiments Reference
MIRT000131 hsa-miR-222-3p Luciferase reporter assay, Western blot, Western blot;Other, Northern blot 17569667
MIRT000131 hsa-miR-222-3p Luciferase reporter assay, Reporter assay 17914108
MIRT000131 hsa-miR-222-3p Luciferase reporter assay, Western blot, Reporter assay 18413744
MIRT000131 hsa-miR-222-3p qRT-PCR, Luciferase reporter assay, Western blot 19153141
MIRT000131 hsa-miR-222-3p Western blot, Northern blot 19107213
Transcription factors
Gene SNPs Transcription factors Other IDs
Transcription factor Regulation Reference
BRCA1 Activation 18025037
BRCA1 Unknown 16331276
COPS5 Repression 16951171
CUX1 Unknown 19332113
ESR1 Repression 17681750
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs Transcription factors Other IDs
GO ID Ontology Definition Evidence Reference
GO:0000079 Process Regulation of cyclin-dependent protein serine/threonine kinase activity IDA 8033212
GO:0000082 Process G1/S transition of mitotic cell cycle IBA 21873635
GO:0000082 Process G1/S transition of mitotic cell cycle IDA 10208428
GO:0000082 Process G1/S transition of mitotic cell cycle TAS
GO:0004860 Function Protein kinase inhibitor activity IMP 8684460
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs Transcription factors Other IDs
MIM
HGNC
e!Ensembl
Protein
Gene SNPs Transcription factors Other IDs
UniProt ID P46527
Protein name Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)
Protein function Important regulator of cell cycle progression. Inhibits the kinase activity of CDK2 bound to cyclin A, but has little inhibitory activity on CDK2 bound to SPDYA (PubMed:28666995). Involved in G1 arrest. Potent inhibitor of cyclin E- and cyclin A-CDK2 complexes. Forms a complex with cyclin type D-CDK4 complexes and is involved in the assembly, stability, and modulation of CCND1-CDK4 complex activation. Acts either as an inhibitor or an activator of cyclin type D-CDK4 complexes depending on its phosphorylation state and/or stoichometry.
PDB 1H27 , 1JSU , 2AST , 5UQ3 , 6ATH , 6P8E , 6P8F , 6P8G , 7B5L , 7B5M , 7B5R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02234 CDI
31 → 79
Cyclin-dependent kinase inhibitor
 Family
Sequence 
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
Sequence length 198
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412