CDH5 (cadherin 5)

Gene

• Entrez ID: 1003
• Gene name: Cadherin 5
• Gene symbol: CDH5
• Synonyms: 7B4, CD144
• Chromosome: 16
• Chromosome location: 16q21
• Summary: This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classical cadherin by imparting to cells the ability to adhere in a homophilic manner, this protein plays a role in endothelial adherens junction assembly and maintenance. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. [provided by RefSeq, Nov 2015]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006257	hsa-miR-211-5p	Luciferase reporter assay	22235338
MIRT017265	hsa-miR-335-5p	Microarray	18185580
MIRT021947	hsa-miR-128-3p	Microarray	17612493
MIRT029178	hsa-miR-26b-5p	Microarray	19088304
MIRT052977	hsa-miR-125b-5p	qRT-PCR, Western blot	22391569
MIRT053051	hsa-miR-101-3p	Luciferase reporter assay, Western blot	23554480
MIRT710468	hsa-miR-544a	HITS-CLIP	19536157
MIRT710469	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT710470	hsa-miR-4763-3p	HITS-CLIP	19536157
MIRT710471	hsa-miR-1207-5p	HITS-CLIP	19536157
MIRT710472	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT710473	hsa-miR-4297	HITS-CLIP	19536157
MIRT710474	hsa-miR-6836-5p	HITS-CLIP	19536157
MIRT710475	hsa-miR-6132	HITS-CLIP	19536157
MIRT710476	hsa-miR-4708-3p	HITS-CLIP	19536157
MIRT710477	hsa-miR-2276-3p	HITS-CLIP	19536157
MIRT710478	hsa-miR-4772-3p	HITS-CLIP	19536157
MIRT710479	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT710480	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT710481	hsa-miR-3918	HITS-CLIP	19536157
MIRT710482	hsa-miR-4761-5p	HITS-CLIP	19536157
MIRT710483	hsa-miR-4512	HITS-CLIP	19536157
MIRT710484	hsa-miR-7843-5p	HITS-CLIP	19536157
MIRT710485	hsa-miR-6879-5p	HITS-CLIP	19536157
MIRT710486	hsa-miR-6735-5p	HITS-CLIP	19536157
MIRT710487	hsa-miR-4632-5p	HITS-CLIP	19536157
MIRT710488	hsa-miR-4436b-3p	HITS-CLIP	19536157
MIRT734860	hsa-miR-27b-3p	Luciferase reporter assay	28396577

Transcription factors

Transcription factor	Regulation	Reference
ERG	Unknown	19359602
KLF4	Activation	20724706

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IBA	21873635
GO:0001932	Process	Regulation of protein phosphorylation	IDA	23159740
GO:0001944	Process	Vasculature development	IBA	21873635
GO:0001955	Process	Blood vessel maturation	IEA
GO:0005102	Function	Signaling receptor binding	IPI	12088286
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	15985432, 17057644, 18287330, 18662404, 20010843, 20123964, 20332120, 21183689, 26923917, 28514442
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA	25978380
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IDA	15572031, 19996314, 20332120, 21168935, 23288152
GO:0005912	Component	Adherens junction	IBA	21873635
GO:0005912	Component	Adherens junction	IDA	25978380, 26598555
GO:0005912	Component	Adherens junction	IMP	26923917
GO:0005923	Component	Bicellular tight junction	IBA	21873635
GO:0006874	Process	Cellular calcium ion homeostasis	IDA	23159740
GO:0007043	Process	Cell-cell junction assembly	IBA	21873635
GO:0007043	Process	Cell-cell junction assembly	IMP	23288152
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	21168935
GO:0007275	Process	Multicellular organism development	IBA	21873635
GO:0008013	Function	Beta-catenin binding	IPI	18287330
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	23288152
GO:0010628	Process	Positive regulation of gene expression	IMP	26598555
GO:0016020	Component	Membrane	TAS	9219219
GO:0016021	Component	Integral component of membrane	IEA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA	21873635
GO:0016342	Component	Catenin complex	IBA	21873635
GO:0019903	Function	Protein phosphatase binding	IPI	28926625
GO:0030054	Component	Cell junction	ISS
GO:0030335	Process	Positive regulation of cell migration	IDA	15572031
GO:0030513	Process	Positive regulation of BMP signaling pathway	IMP	26598555
GO:0031115	Process	Negative regulation of microtubule polymerization	IDA	23159740
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IMP	26598555
GO:0031965	Component	Nuclear membrane	IDA
GO:0034332	Process	Adherens junction organization	IBA	21873635
GO:0034332	Process	Adherens junction organization	IDA	26598555
GO:0034332	Process	Adherens junction organization	TAS
GO:0035307	Process	Positive regulation of protein dephosphorylation	IMP	11950700
GO:0035633	Process	Maintenance of blood-brain barrier	NAS	30280653
GO:0043114	Process	Regulation of vascular permeability	IDA	26598555
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IPI	25893857
GO:0043534	Process	Blood vessel endothelial cell migration	IMP	31934175
GO:0044325	Function	Ion channel binding	IPI	19996314
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IDA	26598555
GO:0045296	Function	Cadherin binding	IBA	21873635
GO:0045766	Process	Positive regulation of angiogenesis	IGI	22391569
GO:0050728	Process	Negative regulation of inflammatory response	IGI	28112401
GO:0070051	Function	Fibrinogen binding	IMP	19413351
GO:0070700	Function	BMP receptor binding	IPI	26598555
GO:0070830	Process	Bicellular tight junction assembly	IMP	25753039
GO:0098609	Process	Cell-cell adhesion	IDA	15572031
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IBA	21873635
GO:1902396	Process	Protein localization to bicellular tight junction	IMP	25753039
GO:1903142	Process	Positive regulation of establishment of endothelial barrier	IMP	23288152
GO:1990782	Function	Protein tyrosine kinase binding	IPI	11950700
GO:2000114	Process	Regulation of establishment of cell polarity	IBA	21873635
GO:2000114	Process	Regulation of establishment of cell polarity	IMP	20332120
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IMP	31934175

Other IDs

• MIM: 601120
• HGNC: 1764
• e!Ensembl: ENSG00000179776

Protein

• UniProt ID: P33151
• Protein name: Cadherin-5 (7B4 antigen) (Vascular endothelial cadherin) (VE-cadherin) (CD antigen CD144)
• Protein function: Cadherins are calcium-dependent cell adhesion proteins (By similarity). They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types (PubMed:21269602). This cadherin may play a important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions (By similarity). It associates with alpha-catenin forming a link to the cytoskeleton (PubMed:10861224). Acts in concert with KRIT1 and PALS1 to establish and maintain correct endothelial cell polarity and vascular lumen (By similarity). These effects are mediated by recruitment and activation of the Par polarity complex and RAP1B (PubMed:20332120). Required for activation of PRKCZ and for the localization of phosphorylated PRKCZ, PARD3, TIAM1 and RAP1B to the cell junction (PubMed:20332120).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00028	Cadherin	52 → 142	Cadherin domain	Domain
  PF00028	Cadherin	156 → 249	Cadherin domain	Domain
  PF00028	Cadherin	263 → 364	Cadherin domain	Domain
  PF00028	Cadherin	377 → 470	Cadherin domain	Domain
  PF00028	Cadherin	483 → 576	Cadherin domain	Domain
  PF01049	Cadherin_C	621 → 777	Cadherin cytoplasmic region	Family

• Sequence:

  MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEK
  NTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTA
  VIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADD
  PTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSG
  TATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRG
  DYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVI
  INITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR
  VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFA
  KPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKY
  GQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQA
  VVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDV
  SVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDG
  DGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPRE
  ELLY

• Sequence length: 784