CD36 (CD36 molecule)

Gene

• Entrez ID: 948
• Gene name: CD36 molecule
• Gene symbol: CD36
• Synonyms: BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3
• Chromosome: 7
• Chromosome location: 7q21.11
• Summary: The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2014]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1049673	C>G,T	Risk-factor	3 prime UTR variant, genic downstream transcript variant
rs1527483	G>A	Risk-factor	Intron variant
rs1761667	G>A	Risk-factor	Genic upstream transcript variant, intron variant
rs1984112	A>C,G,T	Risk-factor	Genic upstream transcript variant, intron variant
rs3211893	T>A,C,G	Likely-pathogenic	Splice donor variant
rs3211938	T>G	Risk-factor, pathogenic, benign	Coding sequence variant, stop gained, intron variant
rs70961716	AAAA>-,AAAAA	Likely-pathogenic	Frameshift variant, intron variant, coding sequence variant
rs75326924	C>T	Pathogenic	Intron variant, 5 prime UTR variant, non coding transcript variant, missense variant, coding sequence variant
rs121918035	A>C,G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs142186404	T>C,G	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs148051111	G>A,C	Likely-pathogenic, uncertain-significance	Splice donor variant
rs148910227	C>G,T	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs550565800	ATTGTGCCTATT>-,ATTGTGCCTATTGTGCCTATT	Pathogenic-likely-pathogenic	Inframe deletion, inframe insertion, coding sequence variant, non coding transcript variant
rs551607784	G>-	Likely-pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs572295823	CA>-	Pathogenic	Coding sequence variant, 5 prime UTR variant, frameshift variant, non coding transcript variant
rs765809606	A>-,AA	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs766920034	->C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, intron variant, frameshift variant
rs771061715	AATAA>-	Likely-pathogenic	Non coding transcript variant, terminator codon variant, frameshift variant
rs1064795310	G>C	Likely-pathogenic	Splice acceptor variant
rs1064795836	G>C	Likely-pathogenic	Splice donor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018933	hsa-miR-335-5p	Microarray	18185580
MIRT021050	hsa-miR-155-5p	Proteomics;Other	20584899
MIRT030109	hsa-miR-26b-5p	Microarray	19088304
MIRT514944	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT514945	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT514946	hsa-miR-5095	PAR-CLIP	23446348
MIRT514947	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT514948	hsa-miR-4529-5p	PAR-CLIP	23446348
MIRT514949	hsa-miR-661	PAR-CLIP	23446348
MIRT514950	hsa-miR-3116	PAR-CLIP	23446348
MIRT514951	hsa-miR-1254	PAR-CLIP	23446348
MIRT514952	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514953	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT514954	hsa-miR-4438	PAR-CLIP	23446348
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23313552
MIRT609641	hsa-miR-8485	HITS-CLIP	27418678
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23313552
MIRT616399	hsa-miR-8064	HITS-CLIP	27418678
MIRT671345	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT671345	hsa-miR-455-5p	HITS-CLIP	27418678
MIRT786000	hsa-miR-448	HITS-CLIP	27418678

Transcription factors

Transcription factor	Regulation	Reference
PPARA	Unknown	16713233;20110263
PPARG	Activation	11795270
PPARG	Unknown	15104237;17322100
RUNX3	Repression	16887969

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001540	Function	Amyloid-beta binding	IC	20037584
GO:0001540	Function	Amyloid-beta binding	IDA	29518356
GO:0001540	Function	Amyloid-beta binding	TAS	20037584
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IDA	17416590
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0002532	Process	Production of molecular mediator involved in inflammatory response	TAS	29111364
GO:0002576	Process	Platelet degranulation	TAS
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IBA	21873635
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IMP	10772654
GO:0005041	Function	Low-density lipoprotein particle receptor activity	TAS	9568716
GO:0005044	Function	Scavenger receptor activity	IBA	21873635
GO:0005044	Function	Scavenger receptor activity	IMP	18941241
GO:0005044	Function	Scavenger receptor activity	TAS	11240025, 29111364
GO:0005324	Function	Long-chain fatty acid transporter activity	IMP	21395585
GO:0005515	Function	Protein binding	IPI	16880211, 18773118, 20037584, 23640500, 32814053
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005794	Component	Golgi apparatus	IDA	16880211
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	22022213, 24503477
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9568716
GO:0005901	Component	Caveola	IBA	21873635
GO:0006629	Process	Lipid metabolic process	NAS	7518447
GO:0006631	Process	Fatty acid metabolic process	TAS	29111364
GO:0006898	Process	Receptor-mediated endocytosis	IBA	21873635
GO:0006898	Process	Receptor-mediated endocytosis	IMP	18941241
GO:0006898	Process	Receptor-mediated endocytosis	TAS
GO:0006910	Process	Phagocytosis, recognition	IEA
GO:0006911	Process	Phagocytosis, engulfment	TAS	29111364
GO:0007155	Process	Cell adhesion	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007263	Process	Nitric oxide mediated signal transduction	IDA	17416590
GO:0007596	Process	Blood coagulation	TAS	2468670
GO:0008035	Function	High-density lipoprotein particle binding	IEA
GO:0008289	Function	Lipid binding	IDA	10772654
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA	21873635
GO:0009986	Component	Cell surface	IDA	10772654
GO:0009986	Component	Cell surface	ISS
GO:0009986	Component	Cell surface	TAS	29111364
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IMP	10772654
GO:0010886	Process	Positive regulation of cholesterol storage	IEA
GO:0010942	Process	Positive regulation of cell death	IMP	27607416
GO:0015636	Function	Short-chain fatty acid transmembrane transporter activity	IMP	21395585
GO:0015909	Process	Long-chain fatty acid transport	IMP	21395585
GO:0015911	Process	Long-chain fatty acid import across plasma membrane	IDA	24503477
GO:0015912	Process	Short-chain fatty acid transport	IMP	21395585
GO:0016020	Component	Membrane	TAS	2468669
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019216	Process	Regulation of lipid metabolic process	TAS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019915	Process	Lipid storage	IBA	21873635
GO:0019915	Process	Lipid storage	IMP	10772654
GO:0019934	Process	CGMP-mediated signaling	IDA	17416590
GO:0030169	Function	Low-density lipoprotein particle binding	IBA	21873635
GO:0030169	Function	Low-density lipoprotein particle binding	IDA	10772654
GO:0030194	Process	Positive regulation of blood coagulation	IEA
GO:0030299	Process	Intestinal cholesterol absorption	ISS
GO:0030301	Process	Cholesterol transport	ISS	12376530
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031092	Component	Platelet alpha granule membrane	TAS
GO:0031526	Component	Brush border membrane	ISS
GO:0031623	Process	Receptor internalization	ISS
GO:0031664	Process	Regulation of lipopolysaccharide-mediated signaling pathway	TAS	29111364
GO:0032611	Process	Interleukin-1 beta production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0033993	Process	Response to lipid	ISS
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	IGI	20037584
GO:0034197	Process	Triglyceride transport	ISS
GO:0034381	Process	Plasma lipoprotein particle clearance	ISS	12376530
GO:0034383	Process	Low-density lipoprotein particle clearance	IBA	21873635
GO:0034383	Process	Low-density lipoprotein particle clearance	IMP	10772654
GO:0035325	Function	Toll-like receptor binding	IPI	20037584
GO:0035579	Component	Specific granule membrane	TAS
GO:0035634	Process	Response to stilbenoid	IEA
GO:0038124	Process	Toll-like receptor TLR6:TLR2 signaling pathway	TAS
GO:0042308	Process	Negative regulation of protein import into nucleus	IEA
GO:0042953	Process	Lipoprotein transport	IBA	21873635
GO:0042953	Process	Lipoprotein transport	IMP	10772654
GO:0042953	Process	Lipoprotein transport	TAS	9568716
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA
GO:0043235	Component	Receptor complex	IPI	20037584
GO:0043254	Process	Regulation of protein-containing complex assembly	IMP	20037584
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0044539	Process	Long-chain fatty acid import into cell	IBA	21873635
GO:0044539	Process	Long-chain fatty acid import into cell	IDA	17416590, 22022213
GO:0044877	Function	Protein-containing complex binding	IPI	29518356
GO:0045121	Component	Membrane raft	IDA	16880211
GO:0045335	Component	Phagocytic vesicle	TAS
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0050431	Function	Transforming growth factor beta binding	ISS
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050892	Process	Intestinal absorption	ISS
GO:0050909	Process	Sensory perception of taste	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IGI	20037584
GO:0055096	Process	Low-density lipoprotein particle mediated signaling	IEA
GO:0060100	Process	Positive regulation of phagocytosis, engulfment	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070053	Function	Thrombospondin receptor activity	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070508	Process	Cholesterol import	ISS
GO:0070542	Process	Response to fatty acid	ISS
GO:0070543	Process	Response to linoleic acid	ISS
GO:0070892	Function	Lipoteichoic acid immune receptor activity	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071223	Process	Cellular response to lipoteichoic acid	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0071447	Process	Cellular response to hydroperoxide	IEA
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	IDA	16880211
GO:0071813	Function	Lipoprotein particle binding	IDA	9568716
GO:0071944	Component	Cell periphery	IDA	26449856
GO:0097009	Process	Energy homeostasis	ISS
GO:0098900	Process	Regulation of action potential	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	25596128
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IMP	27607416
GO:0150024	Process	Oxidised low-density lipoprotein particle clearance	IMP	27607416
GO:0150025	Function	Oxidised low-density lipoprotein particle receptor activity	IMP	27607416
GO:0150094	Process	Amyloid-beta clearance by cellular catabolic process	IBA	21873635
GO:0150094	Process	Amyloid-beta clearance by cellular catabolic process	IMP	18941241
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	ISS
GO:1901480	Function	Oleate transmembrane transporter activity	IDA	24503477
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	ISS
GO:1904646	Process	Cellular response to amyloid-beta	IGI	20037584
GO:1990000	Process	Amyloid fibril formation	ISS
GO:1990379	Process	Lipid transport across blood-brain barrier	IMP	21395585
GO:2000121	Process	Regulation of removal of superoxide radicals	IEA
GO:2000334	Process	Positive regulation of blood microparticle formation	IEA

Other IDs

• MIM: 173510
• HGNC: 1663
• e!Ensembl: ENSG00000135218

Protein

• UniProt ID: P16671
• Protein name: Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (Glycoprotein IIIb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS-4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36)
• Protein function: Multifunctional glycoprotein that acts as receptor for a broad range of ligands. Ligands can be of proteinaceous nature like thrombospondin, fibronectin, collagen or amyloid-beta as well as of lipidic nature such as oxidized low-density lipoprotein (oxLDL), anionic phospholipids, long-chain fatty acids and bacterial diacylated lipopeptides. They are generally multivalent and can therefore engage multiple receptors simultaneously, the resulting formation of CD36 clusters initiates signal transduction and internalization of receptor-ligand complexes. The dependency on coreceptor signaling is strongly ligand specific. Cellular responses to these ligands are involved in angiogenesis, inflammatory response, fatty acid metabolism, taste and dietary fat processing in the intestine (Probable). Binds long-chain fatty acids and facilitates their transport into cells, thus participating in muscle lipid utilization, adipose energy storage, and gut fat absorption (By similarity) (PubMed:18353783, PubMed:21610069). In the small intestine, plays a role in proximal absorption of dietary fatty acid and cholesterol for optimal chylomicron formation, possibly through the activation of MAPK1/3 (ERK1/2) signaling pathway (By similarity) (PubMed:18753675). Involved in oral fat perception and preferences (PubMed:22240721, PubMed:25822988). Detection into the tongue of long-chain fatty acids leads to a rapid and sustained rise in flux and protein content of pancreatobiliary secretions (By similarity). In taste receptor cells, mediates the induction of an increase in intracellular calcium levels by long-chain fatty acids, leading to the activation of the gustatory neurons in the nucleus of the solitary tract (By similarity). Important factor in both ventromedial hypothalamus neuronal sensing of long-chain fatty acid and the regulation of energy and glucose homeostasis (By similarity). Receptor for thombospondins, THBS1 and THBS2, mediating their antiangiogenic effects (By similarity). As a coreceptor for TLR4:TLR6 heterodimer, promotes inflammation in monocytes/macrophages. Upon ligand binding, such as oxLDL or amyloid-beta 42, interacts with the heterodimer TLR4:TLR6, the complex is internalized and triggers inflammatory response, leading to NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion, through the priming and activation of the NLRP3 inflammasome (By similarity) (PubMed:20037584). Selective and nonredundant sensor of microbial diacylated lipopeptide that signal via TLR2:TLR6 heterodimer, this cluster triggers signaling from the cell surface, leading to the NF-kappa-B-dependent production of TNF, via MYD88 signaling pathway and subsequently is targeted to the Golgi in a lipid-raft dependent pathway (By similarity) (PubMed:16880211). ; (Microbial infection) Directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and the internalization of particles independently of TLR signaling.
• PDB: 5LGD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01130	CD36	14 → 463	CD36 family	Family

• Sequence:

  MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTE
  VYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGA
  IFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLW
  GYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE
  SHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAF
  ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGL
  NPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG
  TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

• Sequence length: 472