CD36 (CD36 molecule (CD36 blood group))

Gene

• Entrez ID: 948
• Gene name: CD36 molecule (CD36 blood group)
• Gene symbol: CD36
• Synonyms: BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3
• Chromosome: 7
• Chromosome location: 7q21.11
• Summary: The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhes

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1049673	C>G,T	Risk-factor	3 prime UTR variant, genic downstream transcript variant
rs1527483	G>A	Risk-factor	Intron variant
rs1761667	G>A	Risk-factor	Genic upstream transcript variant, intron variant
rs1984112	A>C,G,T	Risk-factor	Genic upstream transcript variant, intron variant
rs3211893	T>A,C,G	Likely-pathogenic	Splice donor variant
rs3211938	T>G	Risk-factor, pathogenic, benign	Coding sequence variant, stop gained, intron variant
rs70961716	AAAA>-,AAAAA	Likely-pathogenic	Frameshift variant, intron variant, coding sequence variant
rs75326924	C>T	Pathogenic	Intron variant, 5 prime UTR variant, non coding transcript variant, missense variant, coding sequence variant
rs121918035	A>C,G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs142186404	T>C,G	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs148051111	G>A,C	Likely-pathogenic, uncertain-significance	Splice donor variant
rs148910227	C>G,T	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs550565800	ATTGTGCCTATT>-,ATTGTGCCTATTGTGCCTATT	Pathogenic-likely-pathogenic	Inframe deletion, inframe insertion, coding sequence variant, non coding transcript variant
rs551607784	G>-	Likely-pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs572295823	CA>-	Pathogenic	Coding sequence variant, 5 prime UTR variant, frameshift variant, non coding transcript variant
rs765809606	A>-,AA	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs766920034	->C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, intron variant, frameshift variant
rs771061715	AATAA>-	Likely-pathogenic	Non coding transcript variant, terminator codon variant, frameshift variant
rs1064795310	G>C	Likely-pathogenic	Splice acceptor variant
rs1064795836	G>C	Likely-pathogenic	Splice donor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018933	hsa-miR-335-5p	Microarray	18185580
MIRT021050	hsa-miR-155-5p	Proteomics;Other	20584899
MIRT030109	hsa-miR-26b-5p	Microarray	19088304
MIRT609641	hsa-miR-8485	HITS-CLIP	23313552
MIRT616399	hsa-miR-8064	HITS-CLIP	23313552
MIRT609641	hsa-miR-8485	HITS-CLIP	23313552
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT671345	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT671345	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT514954	hsa-miR-4438	PAR-CLIP	23446348
MIRT514953	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT514952	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514951	hsa-miR-1254	PAR-CLIP	23446348
MIRT514950	hsa-miR-3116	PAR-CLIP	23446348
MIRT514949	hsa-miR-661	PAR-CLIP	23446348
MIRT514948	hsa-miR-4529-5p	PAR-CLIP	23446348
MIRT514946	hsa-miR-5095	PAR-CLIP	23446348
MIRT514947	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT514945	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT514944	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT575268	hsa-miR-448	HITS-CLIP	27418678
MIRT575270	hsa-miR-455-5p	HITS-CLIP	27418678
MIRT575270	hsa-miR-455-5p	HITS-CLIP	27418678
MIRT575270	hsa-miR-455-5p	HITS-CLIP	27418678
MIRT575269	hsa-miR-8064	HITS-CLIP	27418678
MIRT575269	hsa-miR-8064	HITS-CLIP	27418678
MIRT575269	hsa-miR-8064	HITS-CLIP	27418678
MIRT575271	hsa-miR-8485	HITS-CLIP	27418678
MIRT575271	hsa-miR-8485	HITS-CLIP	27418678
MIRT575271	hsa-miR-8485	HITS-CLIP	27418678
MIRT732664	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR	33517563
MIRT732664	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR	33517563
MIRT575271	hsa-miR-8485	HITS-CLIP	23313552
MIRT575269	hsa-miR-8064	HITS-CLIP	23313552
MIRT575271	hsa-miR-8485	HITS-CLIP	23313552
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575270	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575270	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT514954	hsa-miR-4438	PAR-CLIP	23446348
MIRT514953	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT514952	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514951	hsa-miR-1254	PAR-CLIP	23446348
MIRT514950	hsa-miR-3116	PAR-CLIP	23446348
MIRT514949	hsa-miR-661	PAR-CLIP	23446348
MIRT514948	hsa-miR-4529-5p	PAR-CLIP	23446348
MIRT514946	hsa-miR-5095	PAR-CLIP	23446348
MIRT514947	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT514945	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT514944	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT875165	hsa-miR-1193	CLIP-seq
MIRT875166	hsa-miR-146a	CLIP-seq
MIRT875167	hsa-miR-146b-5p	CLIP-seq
MIRT875168	hsa-miR-155	CLIP-seq
MIRT875169	hsa-miR-197	CLIP-seq
MIRT875170	hsa-miR-1972	CLIP-seq
MIRT875171	hsa-miR-1976	CLIP-seq
MIRT875172	hsa-miR-2392	CLIP-seq
MIRT875173	hsa-miR-3129-3p	CLIP-seq
MIRT875174	hsa-miR-3163	CLIP-seq
MIRT875175	hsa-miR-3173-3p	CLIP-seq
MIRT875176	hsa-miR-338-5p	CLIP-seq
MIRT875177	hsa-miR-3529	CLIP-seq
MIRT875178	hsa-miR-374c	CLIP-seq
MIRT875179	hsa-miR-379	CLIP-seq
MIRT875180	hsa-miR-3942-3p	CLIP-seq
MIRT875181	hsa-miR-3975	CLIP-seq
MIRT875182	hsa-miR-4266	CLIP-seq
MIRT875183	hsa-miR-4320	CLIP-seq
MIRT875184	hsa-miR-4328	CLIP-seq
MIRT875185	hsa-miR-4428	CLIP-seq
MIRT875186	hsa-miR-4435	CLIP-seq
MIRT875187	hsa-miR-4451	CLIP-seq
MIRT875188	hsa-miR-4536	CLIP-seq
MIRT875189	hsa-miR-4633-3p	CLIP-seq
MIRT875190	hsa-miR-4650-3p	CLIP-seq
MIRT875191	hsa-miR-4666-3p	CLIP-seq
MIRT875192	hsa-miR-4691-3p	CLIP-seq
MIRT875193	hsa-miR-4695-3p	CLIP-seq
MIRT875194	hsa-miR-4695-5p	CLIP-seq
MIRT875195	hsa-miR-4701-5p	CLIP-seq
MIRT875196	hsa-miR-4716-5p	CLIP-seq
MIRT875197	hsa-miR-4729	CLIP-seq
MIRT875198	hsa-miR-4781-3p	CLIP-seq
MIRT875199	hsa-miR-4796-3p	CLIP-seq
MIRT875200	hsa-miR-4797-5p	CLIP-seq
MIRT875201	hsa-miR-4803	CLIP-seq
MIRT875202	hsa-miR-5096	CLIP-seq
MIRT875203	hsa-miR-520g	CLIP-seq
MIRT875204	hsa-miR-520h	CLIP-seq
MIRT875205	hsa-miR-548n	CLIP-seq
MIRT875206	hsa-miR-548s	CLIP-seq
MIRT875207	hsa-miR-548t	CLIP-seq
MIRT875208	hsa-miR-577	CLIP-seq
MIRT875209	hsa-miR-588	CLIP-seq
MIRT875210	hsa-miR-640	CLIP-seq
MIRT875211	hsa-miR-651	CLIP-seq
MIRT875212	hsa-miR-655	CLIP-seq
MIRT875213	hsa-miR-765	CLIP-seq
MIRT1959473	hsa-miR-1207-3p	CLIP-seq
MIRT1959474	hsa-miR-122	CLIP-seq
MIRT1959475	hsa-miR-1226	CLIP-seq
MIRT1959476	hsa-miR-2355-3p	CLIP-seq
MIRT1959477	hsa-miR-3121-5p	CLIP-seq
MIRT1959478	hsa-miR-3135b	CLIP-seq
MIRT1959479	hsa-miR-3199	CLIP-seq
MIRT1959480	hsa-miR-3647-3p	CLIP-seq
MIRT1959481	hsa-miR-3652	CLIP-seq
MIRT1959482	hsa-miR-4430	CLIP-seq
MIRT1959483	hsa-miR-450b-5p	CLIP-seq
MIRT1959484	hsa-miR-4652-3p	CLIP-seq
MIRT875193	hsa-miR-4695-3p	CLIP-seq
MIRT1959485	hsa-miR-4733-3p	CLIP-seq
MIRT1959486	hsa-miR-4740-3p	CLIP-seq
MIRT1959487	hsa-miR-4766-5p	CLIP-seq
MIRT1959488	hsa-miR-646	CLIP-seq
MIRT1959489	hsa-miR-676	CLIP-seq
MIRT875165	hsa-miR-1193	CLIP-seq
MIRT1959473	hsa-miR-1207-3p	CLIP-seq
MIRT1959474	hsa-miR-122	CLIP-seq
MIRT1959475	hsa-miR-1226	CLIP-seq
MIRT2196457	hsa-miR-1915	CLIP-seq
MIRT2196458	hsa-miR-2115	CLIP-seq
MIRT875172	hsa-miR-2392	CLIP-seq
MIRT1959478	hsa-miR-3135b	CLIP-seq
MIRT2196459	hsa-miR-3155	CLIP-seq
MIRT2196460	hsa-miR-3155b	CLIP-seq
MIRT1959481	hsa-miR-3652	CLIP-seq
MIRT2196461	hsa-miR-4264	CLIP-seq
MIRT2196462	hsa-miR-4277	CLIP-seq
MIRT2196463	hsa-miR-4420	CLIP-seq
MIRT1959482	hsa-miR-4430	CLIP-seq
MIRT875186	hsa-miR-4435	CLIP-seq
MIRT875193	hsa-miR-4695-3p	CLIP-seq
MIRT875195	hsa-miR-4701-5p	CLIP-seq
MIRT875196	hsa-miR-4716-5p	CLIP-seq
MIRT2196464	hsa-miR-4726-3p	CLIP-seq
MIRT1959485	hsa-miR-4733-3p	CLIP-seq
MIRT2196465	hsa-miR-4772-3p	CLIP-seq
MIRT875198	hsa-miR-4781-3p	CLIP-seq
MIRT2196466	hsa-miR-4797-3p	CLIP-seq
MIRT2196467	hsa-miR-484	CLIP-seq
MIRT2196468	hsa-miR-516a-3p	CLIP-seq
MIRT2196469	hsa-miR-539	CLIP-seq
MIRT875206	hsa-miR-548s	CLIP-seq
MIRT875209	hsa-miR-588	CLIP-seq
MIRT1959488	hsa-miR-646	CLIP-seq
MIRT2385741	hsa-miR-128	CLIP-seq
MIRT2385742	hsa-miR-140-3p	CLIP-seq
MIRT2385743	hsa-miR-148a	CLIP-seq
MIRT2385744	hsa-miR-148b	CLIP-seq
MIRT2385745	hsa-miR-152	CLIP-seq
MIRT2446587	hsa-miR-3156-5p	CLIP-seq
MIRT2446588	hsa-miR-3200-5p	CLIP-seq
MIRT2446589	hsa-miR-339-5p	CLIP-seq
MIRT2446590	hsa-miR-4477a	CLIP-seq
MIRT2446591	hsa-miR-4682	CLIP-seq
MIRT2446592	hsa-miR-4742-3p	CLIP-seq
MIRT2499480	hsa-miR-1228	CLIP-seq
MIRT2499481	hsa-miR-1263	CLIP-seq
MIRT2499482	hsa-miR-1269	CLIP-seq
MIRT2499483	hsa-miR-1269b	CLIP-seq
MIRT2499484	hsa-miR-203	CLIP-seq
MIRT2499485	hsa-miR-223	CLIP-seq
MIRT2499486	hsa-miR-329	CLIP-seq
MIRT2499487	hsa-miR-362-3p	CLIP-seq
MIRT875178	hsa-miR-374c	CLIP-seq
MIRT2499488	hsa-miR-3941	CLIP-seq
MIRT2499489	hsa-miR-4529-3p	CLIP-seq
MIRT2499490	hsa-miR-4697-3p	CLIP-seq
MIRT2499491	hsa-miR-4760-3p	CLIP-seq
MIRT2499492	hsa-miR-548a-3p	CLIP-seq
MIRT2499493	hsa-miR-548ae	CLIP-seq
MIRT2499494	hsa-miR-548aj	CLIP-seq
MIRT2499495	hsa-miR-548am	CLIP-seq
MIRT2499496	hsa-miR-548e	CLIP-seq
MIRT2499497	hsa-miR-548f	CLIP-seq
MIRT2499498	hsa-miR-548x	CLIP-seq
MIRT2499499	hsa-miR-603	CLIP-seq
MIRT875212	hsa-miR-655	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PPARA	Unknown	16713233;20110263
PPARG	Activation	11795270
PPARG	Unknown	15104237;17322100
RUNX3	Repression	16887969

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001540	Function	Amyloid-beta binding	IC	20037584
GO:0001540	Function	Amyloid-beta binding	IDA	29518356
GO:0001540	Function	Amyloid-beta binding	TAS	20037584
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IDA	17416590
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0002532	Process	Production of molecular mediator involved in inflammatory response	TAS	29111364
GO:0002576	Process	Platelet degranulation	TAS
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IBA	21873635
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IMP	10772654
GO:0005041	Function	Low-density lipoprotein particle receptor activity	TAS	9568716
GO:0005044	Function	Scavenger receptor activity	IBA	21873635
GO:0005044	Function	Scavenger receptor activity	IMP	18941241
GO:0005044	Function	Scavenger receptor activity	TAS	11240025, 29111364
GO:0005324	Function	Long-chain fatty acid transporter activity	IMP	21395585
GO:0005515	Function	Protein binding	IPI	16880211, 18773118, 20037584, 23640500, 32814053
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005794	Component	Golgi apparatus	IDA	16880211
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	22022213, 24503477
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9568716
GO:0005901	Component	Caveola	IBA	21873635
GO:0006629	Process	Lipid metabolic process	NAS	7518447
GO:0006631	Process	Fatty acid metabolic process	TAS	29111364
GO:0006898	Process	Receptor-mediated endocytosis	IBA	21873635
GO:0006898	Process	Receptor-mediated endocytosis	IMP	18941241
GO:0006898	Process	Receptor-mediated endocytosis	TAS
GO:0006910	Process	Phagocytosis, recognition	IEA
GO:0006911	Process	Phagocytosis, engulfment	TAS	29111364
GO:0007155	Process	Cell adhesion	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007263	Process	Nitric oxide mediated signal transduction	IDA	17416590
GO:0007596	Process	Blood coagulation	TAS	2468670
GO:0008035	Function	High-density lipoprotein particle binding	IEA
GO:0008289	Function	Lipid binding	IDA	10772654
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA	21873635
GO:0009986	Component	Cell surface	IDA	10772654
GO:0009986	Component	Cell surface	ISS
GO:0009986	Component	Cell surface	TAS	29111364
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IMP	10772654
GO:0010886	Process	Positive regulation of cholesterol storage	IEA
GO:0010942	Process	Positive regulation of cell death	IMP	27607416
GO:0015636	Function	Short-chain fatty acid transmembrane transporter activity	IMP	21395585
GO:0015909	Process	Long-chain fatty acid transport	IMP	21395585
GO:0015911	Process	Long-chain fatty acid import across plasma membrane	IDA	24503477
GO:0015912	Process	Short-chain fatty acid transport	IMP	21395585
GO:0016020	Component	Membrane	TAS	2468669
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019216	Process	Regulation of lipid metabolic process	TAS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019915	Process	Lipid storage	IBA	21873635
GO:0019915	Process	Lipid storage	IMP	10772654
GO:0019934	Process	CGMP-mediated signaling	IDA	17416590
GO:0030169	Function	Low-density lipoprotein particle binding	IBA	21873635
GO:0030169	Function	Low-density lipoprotein particle binding	IDA	10772654
GO:0030194	Process	Positive regulation of blood coagulation	IEA
GO:0030299	Process	Intestinal cholesterol absorption	ISS
GO:0030301	Process	Cholesterol transport	ISS	12376530
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031092	Component	Platelet alpha granule membrane	TAS
GO:0031526	Component	Brush border membrane	ISS
GO:0031623	Process	Receptor internalization	ISS
GO:0031664	Process	Regulation of lipopolysaccharide-mediated signaling pathway	TAS	29111364
GO:0032611	Process	Interleukin-1 beta production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0033993	Process	Response to lipid	ISS
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	IGI	20037584
GO:0034197	Process	Triglyceride transport	ISS
GO:0034381	Process	Plasma lipoprotein particle clearance	ISS	12376530
GO:0034383	Process	Low-density lipoprotein particle clearance	IBA	21873635
GO:0034383	Process	Low-density lipoprotein particle clearance	IMP	10772654
GO:0035325	Function	Toll-like receptor binding	IPI	20037584
GO:0035579	Component	Specific granule membrane	TAS
GO:0035634	Process	Response to stilbenoid	IEA
GO:0038124	Process	Toll-like receptor TLR6:TLR2 signaling pathway	TAS
GO:0042308	Process	Negative regulation of protein import into nucleus	IEA
GO:0042953	Process	Lipoprotein transport	IBA	21873635
GO:0042953	Process	Lipoprotein transport	IMP	10772654
GO:0042953	Process	Lipoprotein transport	TAS	9568716
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA
GO:0043235	Component	Receptor complex	IPI	20037584
GO:0043254	Process	Regulation of protein-containing complex assembly	IMP	20037584
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0044539	Process	Long-chain fatty acid import into cell	IBA	21873635
GO:0044539	Process	Long-chain fatty acid import into cell	IDA	17416590, 22022213
GO:0044877	Function	Protein-containing complex binding	IPI	29518356
GO:0045121	Component	Membrane raft	IDA	16880211
GO:0045335	Component	Phagocytic vesicle	TAS
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0050431	Function	Transforming growth factor beta binding	ISS
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050892	Process	Intestinal absorption	ISS
GO:0050909	Process	Sensory perception of taste	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IGI	20037584
GO:0055096	Process	Low-density lipoprotein particle mediated signaling	IEA
GO:0060100	Process	Positive regulation of phagocytosis, engulfment	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070053	Function	Thrombospondin receptor activity	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070508	Process	Cholesterol import	ISS
GO:0070542	Process	Response to fatty acid	ISS
GO:0070543	Process	Response to linoleic acid	ISS
GO:0070892	Function	Lipoteichoic acid immune receptor activity	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071223	Process	Cellular response to lipoteichoic acid	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0071447	Process	Cellular response to hydroperoxide	IEA
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	IDA	16880211
GO:0071813	Function	Lipoprotein particle binding	IDA	9568716
GO:0071944	Component	Cell periphery	IDA	26449856
GO:0097009	Process	Energy homeostasis	ISS
GO:0098900	Process	Regulation of action potential	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	25596128
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IMP	27607416
GO:0150024	Process	Oxidised low-density lipoprotein particle clearance	IMP	27607416
GO:0150025	Function	Oxidised low-density lipoprotein particle receptor activity	IMP	27607416
GO:0150094	Process	Amyloid-beta clearance by cellular catabolic process	IBA	21873635
GO:0150094	Process	Amyloid-beta clearance by cellular catabolic process	IMP	18941241
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	ISS
GO:1901480	Function	Oleate transmembrane transporter activity	IDA	24503477
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	ISS
GO:1904646	Process	Cellular response to amyloid-beta	IGI	20037584
GO:1990000	Process	Amyloid fibril formation	ISS
GO:1990379	Process	Lipid transport across blood-brain barrier	IMP	21395585
GO:2000121	Process	Regulation of removal of superoxide radicals	IEA
GO:2000334	Process	Positive regulation of blood microparticle formation	IEA

Other IDs

• MIM: 173510
• HGNC: 1663
• e!Ensembl: ENSG00000135218

Protein

• UniProt ID: P16671
• Protein name: Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (Glycoprotein IIIb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS-4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36)
• Protein function: Multifunctional glycoprotein that acts as a receptor for a broad range of ligands. Ligands can be of proteinaceous nature like thrombospondin, fibronectin, collagen or amyloid-beta as well as of lipidic nature such as oxidized low-density lipopr
• PDB: 5LGD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01130	CD36	14 → 463	CD36 family	Family

• Sequence:

  MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTE
  VYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGA
  IFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLW
  GYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE
  SHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAF
  ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGL
  NPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG
  TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

• Sequence length: 472