CCNA1 (cyclin A1)

Gene

• Entrez ID: 8900
• Gene name: Cyclin A1
• Gene symbol: CCNA1
• Synonyms: CT146
• Chromosome: 13
• Chromosome location: 13q13.3
• Summary: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. The cyclin encoded by this gene was shown to be expressed in testis and brain, as well as in several leukemic cell lines, and is thought to primarily function in the control of the germline meiotic cell cycle. This cyclin binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. This cyclin was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006767	hsa-miR-372-3p	FACS, GFP reporter assay, qRT-PCR, Western blot	21646351
MIRT018229	hsa-miR-335-5p	Microarray	18185580
MIRT022823	hsa-miR-124-3p	Microarray	18668037
MIRT032444	hsa-let-7b-5p	Reporter assay	18379589

Transcription factors

Transcription factor	Regulation	Reference
ATF1	Repression	12044952
CREM	Unknown	7760825
KDM4B	Unknown	20682797
MYB	Activation	10590070
MYBL2	Unknown	11264176;15922873
RARA	Repression	11090075
TP53	Unknown	17530187

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	21873635
GO:0000083	Process	Regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA	21873635
GO:0005515	Function	Protein binding	IPI	8756624, 15159402, 15232106, 18692475, 21540187, 25241761, 29997244, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS	9041194
GO:0007141	Process	Male meiosis I	TAS	9843212
GO:0007283	Process	Spermatogenesis	TAS	9843212
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA	21873635
GO:0016579	Process	Protein deubiquitination	TAS
GO:0044772	Process	Mitotic cell cycle phase transition	IBA	21873635
GO:0051301	Process	Cell division	IEA
GO:0097123	Component	Cyclin A1-CDK2 complex	IEA
GO:0097124	Component	Cyclin A2-CDK2 complex	IBA	21873635
GO:0097124	Component	Cyclin A2-CDK2 complex	IDA	18305109

Other IDs

• MIM: 604036
• HGNC: 1577
• e!Ensembl: ENSG00000133101

Protein

• UniProt ID: P78396
• Protein name: Cyclin-A1
• Protein function: May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00134	Cyclin_N	214 → 340	Cyclin, N-terminal domain	Domain
  PF02984	Cyclin_C	342 → 459	Cyclin, C-terminal domain	Domain

• Sequence:

  METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVA
  RGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKK
  ALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFN
  TVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDIT
  EGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKY
  EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVR
  TENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV
  PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ

• Sequence length: 465