GediPNet logo

CCM2 (CCM2 scaffold protein)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83605
Gene nameGene Name - the full gene name approved by the HGNC.
CCM2 scaffold protein
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CCM2
SynonymsGene synonyms aliases
C7orf22, OSM, PP10187
ChromosomeChromosome number
7
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p13
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a scaffold protein that functions in the stress-activated p38 Mitogen-activated protein kinase (MAPK) signaling cascade. The protein interacts with SMAD specific E3 ubiquitin protein ligase 1 (also known as SMURF1) via a phosphotyrosine binding domain to promote RhoA degradation. The protein is required for normal cytoskeletal structure, cell-cell interactions, and lumen formation in endothelial cells. Mutations in this gene result in cerebral cavernous malformations. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2009]
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137852841 C>T Pathogenic Non coding transcript variant, coding sequence variant, stop gained
rs137852843 T>G Pathogenic Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs755800734 C>T Pathogenic Intron variant, coding sequence variant, non coding transcript variant, stop gained
rs765548101 C>G,T Pathogenic Non coding transcript variant, coding sequence variant, stop gained, synonymous variant
rs886041157 C>T Pathogenic Stop gained, coding sequence variant, non coding transcript variant
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001570 Process Vasculogenesis IMP 14740320
GO:0001701 Process In utero embryonic development IEA
GO:0001885 Process Endothelial cell development IEA
GO:0005515 Function Protein binding IPI 16037064, 17657516, 20489202, 23007647, 23266514, 25525273, 25814554, 25910212, 32296183
GO:0005737 Component Cytoplasm IDA 16037064
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9BSQ5
Protein name Cerebral cavernous malformations 2 protein (Malcavernin)
Protein function Component of the CCM signaling pathway which is a crucial regulator of heart and vessel formation and integrity. May act through the stabilization of endothelial cell junctions (By similarity). May function as a scaffold protein for MAP2K3-MAP3K3 signaling. Seems to play a major role in the modulation of MAP3K3-dependent p38 activation induced by hyperosmotic shock (By similarity).
PDB 4FQN , 4TVQ , 4WJ7 , 4Y5O , 4YKC , 4YKD , 4YL6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16545 CCM2_C
287 387
Cerebral cavernous malformation protein, harmonin-homology
Domain
Sequence
MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLS
DYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNV
KLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQDPGISPSQSLCAESSRGLSAG
SLSESAVGPVEACCLVILAAESKVAAEELCCLLGQVFQVVYTESTIDFLDRAIFDGASTP
THHLSLHSDDSSTKVDIKETYEVEASTFCFPESVDVGGASPHSKTISESELSASATELLQ
DYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLLLGLRPFIPEK
DSQHFENFLETIGVKDGRGIITDSFGR
HRRALSTTSSSTTNGNRATGSSDDRSAPSEGDE
WDRMISDISSDIEALGCSMDQDSA
Sequence length 444
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412