CASP3 (caspase 3)

Gene

• Entrez ID: 836
• Gene name: Caspase 3
• Gene symbol: CASP3
• Synonyms: CPP32, CPP32B, SCA-1
• Chromosome: 4
• Chromosome location: 4q35.1
• Summary: The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer`s disease. [provided by RefSeq, Aug 2017]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003574	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	26367177
MIRT005292	hsa-let-7a-5p	Luciferase reporter assay, Western blot	18758960
MIRT006240	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	22058146
MIRT006240	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT006864	hsa-miR-138-5p	Luciferase reporter assay	22921398
MIRT019884	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT021992	hsa-miR-128-3p	Sequencing	20371350
MIRT024157	hsa-miR-221-3p	Sequencing	20371350
MIRT029617	hsa-miR-26b-5p	Microarray	19088304
MIRT048249	hsa-miR-196a-5p	CLASH	23622248
MIRT054129	hsa-miR-421	qRT-PCR, Western blot	25041019
MIRT054129	hsa-miR-421	Luciferase reporter assay, Immunofluorescence, Immunohistochemistry, qRT-PCR, Western blot	27016414
MIRT054642	hsa-let-7g-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	24252910
MIRT164579	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT164595	hsa-miR-6124	PAR-CLIP	23592263
MIRT356254	hsa-let-7b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26296645
MIRT437365	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT437365	hsa-miR-30c-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	22964638
MIRT438729	hsa-miR-582-5p	Flow, Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24805821
MIRT438730	hsa-miR-363-3p	Flow, Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24805821
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT441002	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT441003	hsa-miR-382-5p	HITS-CLIP	24374217
MIRT487451	hsa-miR-3680-3p	PAR-CLIP	23592263
MIRT487452	hsa-miR-4666b	PAR-CLIP	23592263
MIRT487453	hsa-miR-5011-3p	PAR-CLIP	23592263
MIRT487454	hsa-miR-6797-3p	PAR-CLIP	23592263
MIRT487455	hsa-miR-6076	PAR-CLIP	23592263
MIRT487456	hsa-miR-888-5p	PAR-CLIP	23592263
MIRT487457	hsa-miR-562	PAR-CLIP	23592263
MIRT487458	hsa-miR-548n	PAR-CLIP	23592263
MIRT728048	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT728048	hsa-miR-30e-5p	Luciferase reporter assay	26895377
MIRT728049	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT728050	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT732067	hsa-miR-224-5p	Luciferase reporter assay, Western blot	26307684
MIRT733184	hsa-miR-26a-1-3p	qRT-PCR, Western blot	27517917
MIRT733975	hsa-miR-34a-5p	PCR array	28097098
MIRT734589	hsa-miR-155-5p	Luciferase reporter assay	26574931
MIRT735135	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR, Western blot	25934573

Transcription factors

Transcription factor	Regulation	Reference
ING1	Activation	15662138
ING4	Activation	19895734
NFKB1	Unknown	20056115
PHF10	Unknown	20530714
PML	Activation	16253165
RELA	Unknown	20056115
RUNX3	Activation	15930301;19290488
SIM2	Activation	21729534
SP1	Unknown	11773055
TP53	Unknown	21859835

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001554	Process	Luteolysis	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001782	Process	B cell homeostasis	IEA
GO:0002020	Function	Protease binding	IEA
GO:0004190	Function	Aspartic-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	16920334, 19240112, 21726810, 24904167
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IEA
GO:0005123	Function	Death receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	7596430, 9208847, 9736630, 11257232, 15246877, 16227597, 16501604, 16530191, 17167422, 17544405, 17606900, 17823127, 18723680, 19273858, 21726810, 23150525, 25241761, 28514442, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	17167422
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA	17167422, 17823127, 22253444
GO:0005829	Component	Cytosol	TAS
GO:0006309	Process	Apoptotic DNA fragmentation	TAS
GO:0006508	Process	Proteolysis	IDA	12888622, 17553422
GO:0006915	Process	Apoptotic process	IBA	21873635
GO:0006915	Process	Apoptotic process	IMP	15565177
GO:0006974	Process	Cellular response to DNA damage stimulus	IEA
GO:0007413	Process	Axonal fasciculation	IEA
GO:0007507	Process	Heart development	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0008233	Function	Peptidase activity	IDA	9353287, 17167422, 19740745
GO:0008627	Process	Intrinsic apoptotic signaling pathway in response to osmotic stress	IEA
GO:0009411	Process	Response to UV	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010165	Process	Response to X-ray	IEA
GO:0016005	Function	Phospholipase A2 activator activity	IEA
GO:0016241	Process	Regulation of macroautophagy	TAS	19549685
GO:0016485	Process	Protein processing	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0021766	Process	Hippocampus development	IEA
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0030216	Process	Keratinocyte differentiation	IBA	21873635
GO:0030218	Process	Erythrocyte differentiation	IBA	21873635
GO:0030218	Process	Erythrocyte differentiation	IDA	17167422
GO:0030218	Process	Erythrocyte differentiation	TAS	18309324
GO:0030220	Process	Platelet formation	TAS	18309324
GO:0030889	Process	Negative regulation of B cell proliferation	IEA
GO:0031264	Component	Death-inducing signaling complex	IEA
GO:0031647	Process	Regulation of protein stability	IDA	17553422
GO:0032025	Process	Response to cobalt ion	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034349	Process	Glial cell apoptotic process	IEA
GO:0034612	Process	Response to tumor necrosis factor	TAS	10521396
GO:0035094	Process	Response to nicotine	IEA
GO:0035329	Process	Hippo signaling	TAS
GO:0042060	Process	Wound healing	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	IGI	9353287
GO:0043200	Process	Response to amino acid	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0046007	Process	Negative regulation of activated T cell proliferation	IEA
GO:0046677	Process	Response to antibiotic	IEA
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IDA	23954828
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0061713	Process	Anterior neural tube closure	IEA
GO:0071887	Process	Leukocyte apoptotic process	IEA
GO:0072734	Process	Cellular response to staurosporine	IMP	22253444
GO:0097153	Function	Cysteine-type endopeptidase activity involved in apoptotic process	IBA	21873635
GO:0097153	Function	Cysteine-type endopeptidase activity involved in apoptotic process	IDA	23729654
GO:0097153	Function	Cysteine-type endopeptidase activity involved in apoptotic process	IMP	10921886
GO:0097190	Process	Apoptotic signaling pathway	TAS	10521396
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	TAS
GO:0097194	Process	Execution phase of apoptosis	IDA	8689682
GO:0097194	Process	Execution phase of apoptosis	IMP	11350920
GO:0097194	Process	Execution phase of apoptosis	TAS
GO:0097199	Function	Cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	21980415
GO:0097200	Function	Cysteine-type endopeptidase activity involved in execution phase of apoptosis	IMP	17559062, 22253444
GO:1902004	Process	Positive regulation of amyloid-beta formation	IDA	17553422

Other IDs

• MIM: 600636
• HGNC: 1504
• e!Ensembl: ENSG00000164305

Protein

• UniProt ID: P42574
• Protein name: Caspase-3 (CASP-3) (EC 3.4.22.56) (Apopain) (Cysteine protease CPP32) (CPP-32) (Protein Yama) (SREBP cleavage activity 1) (SCA-1) [Cleaved into: Caspase-3 subunit p17; Caspase-3 subunit p12]
• Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution (PubMed:7596430). At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond (PubMed:7774019). Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9 (PubMed:7596430). Involved in the cleavage of huntingtin (PubMed:8696339). Triggers cell adhesion in sympathetic neurons through RET cleavage (PubMed:21357690). Cleaves and inhibits serine/threonine-protein kinase AKT1 in response to oxidative stress (PubMed:23152800).
• PDB: 1CP3, 1GFW, 1I3O, 1NME, 1NMQ, 1NMS, 1PAU, 1QX3, 1RE1, 1RHJ, 1RHK, 1RHM, 1RHQ, 1RHR, 1RHU, 2C1E, 2C2K, 2C2M, 2C2O, 2CDR, 2CJX, 2CJY, 2CNK, 2CNL, 2CNN, 2CNO, 2DKO, 2H5I, 2H5J, 2H65, 2J30, 2J31, 2J32, 2J33, 2XYG, 2XYH, 2XYP, 2XZD, 2XZT, 2Y0B, 3DEH, 3DEI, 3DEJ, 3DEK, 3EDQ, 3GJQ, 3GJR, 3GJS, 3GJT, 3H0E, 3ITN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00656	Peptidase_C14	45 → 275		Domain

• Sequence:

  MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
  MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
  HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
  DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
  RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH

• Sequence length: 277