CAMK2G (calcium/calmodulin dependent protein kinase II gamma)

Gene

• Entrez ID: 818
• Gene name: Calcium/calmodulin dependent protein kinase II gamma
• Gene symbol: CAMK2G
• Synonyms: CAMK, CAMK-II, CAMKG, MRD59
• Chromosome: 10
• Chromosome location: 10q22.2
• Summary: The product of this gene is one of the four subunits of an enzyme which belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a gamma chain. Many alternatively spliced transcripts encoding different isoforms have been described but the full-length nature of all the variants has not been determined.[provided by RefSeq, Mar 2011]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs397514627	C>A,G	Likely-pathogenic, pathogenic	Coding sequence variant, non coding transcript variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004446	hsa-miR-219a-5p	Luciferase reporter assay	19196972
MIRT024052	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT031976	hsa-miR-16-5p	Proteomics	18668040
MIRT043311	hsa-miR-331-3p	CLASH	23622248
MIRT053737	hsa-miR-1268a	Microarray	22942087
MIRT659897	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT659898	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT659899	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT659900	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT659901	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT659902	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT659903	hsa-miR-623	HITS-CLIP	23824327
MIRT659904	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT659905	hsa-miR-4704-5p	HITS-CLIP	23824327
MIRT659906	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT720322	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT720323	hsa-miR-3156-3p	HITS-CLIP	19536157
MIRT720324	hsa-miR-2116-3p	HITS-CLIP	19536157
MIRT720325	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT720326	hsa-miR-4301	HITS-CLIP	19536157
MIRT720327	hsa-miR-1273g-3p	HITS-CLIP	19536157
MIRT720328	hsa-miR-6890-3p	HITS-CLIP	19536157
MIRT720329	hsa-miR-483-3p	HITS-CLIP	19536157

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004683	Function	Calmodulin-dependent protein kinase activity	IBA	21873635
GO:0004723	Function	Calcium-dependent protein serine/threonine phosphatase activity	NAS	9060999
GO:0005515	Function	Protein binding	IPI	22939624
GO:0005516	Function	Calmodulin binding	IBA	21873635
GO:0005516	Function	Calmodulin binding	NAS	9060999
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005954	Component	Calcium- and calmodulin-dependent protein kinase complex	IDA	20668654
GO:0006468	Process	Protein phosphorylation	IEA
GO:0006470	Process	Protein dephosphorylation	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0010975	Process	Regulation of neuron projection development	IMP	30184290
GO:0014733	Process	Regulation of skeletal muscle adaptation	TAS	15294044
GO:0016020	Component	Membrane	HDA	19946888
GO:0030073	Process	Insulin secretion	NAS	9240463
GO:0030154	Process	Cell differentiation	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0033017	Component	Sarcoplasmic reticulum membrane	IEA
GO:0042802	Function	Identical protein binding	IPI	20668654
GO:0042803	Function	Protein homodimerization activity	IPI	20668654
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0051924	Process	Regulation of calcium ion transport	TAS	15294044
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:1900034	Process	Regulation of cellular response to heat	TAS

Other IDs

• MIM: 602123
• HGNC: 1463
• e!Ensembl: ENSG00000148660

Protein

• UniProt ID: Q13555
• Protein name: Calcium/calmodulin-dependent protein kinase type II subunit gamma (CaM kinase II subunit gamma) (CaMK-II subunit gamma) (EC 2.7.11.17)
• Protein function: Calcium/calmodulin-dependent protein kinase that functions autonomously after Ca(2+)/calmodulin-binding and autophosphorylation, and is involved in sarcoplasmic reticulum Ca(2+) transport in skeletal muscle and may function in dendritic spine and synapse formation and neuronal plasticity. In slow-twitch muscles, is involved in regulation of sarcoplasmic reticulum (SR) Ca(2+) transport and in fast-twitch muscle participates in the control of Ca(2+) release from the SR through phosphorylation of the ryanodine receptor-coupling factor triadin. In the central nervous system, it is involved in the regulation of neurite formation and arborization (PubMed:30184290). It may participate in the promotion of dendritic spine and synapse formation and maintenance of synaptic plasticity which enables long-term potentiation (LTP) and hippocampus-dependent learning.
• PDB: 2UX0, 2V7O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	14 → 272	Protein kinase domain	Domain
  PF08332	CaMKII_AD	426 → 553	Calcium/calmodulin dependent protein kinase II association domain	Domain

• Sequence:

  MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
  EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
  LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
  LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
  VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
  KGAILTTMLVSRNFSAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPL
  QTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKGRVPEGRSSRDRTAPSAGMQPQPSL
  CSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFE
  NLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDG
  KWLNVHYHCSGAPAAPLQ

• Sequence length: 558