CACNG7 (calcium voltage-gated channel auxiliary subunit gamma 7)

Gene

• Entrez ID: 59284
• Gene name: Calcium voltage-gated channel auxiliary subunit gamma 7
• Gene symbol: CACNG7
• Synonyms: -
• Chromosome: 19
• Chromosome location: 19q13.42
• Summary: The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members, a type I TARP and a calcium channel gamma subunit. [provided by RefSeq, Dec 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT508847	hsa-miR-599	PAR-CLIP	23446348
MIRT508847	hsa-miR-599	PAR-CLIP	22012620
MIRT508847	hsa-miR-599	PAR-CLIP	20371350
MIRT508848	hsa-miR-3161	PAR-CLIP	23446348
MIRT508848	hsa-miR-3161	PAR-CLIP	22012620
MIRT508848	hsa-miR-3161	PAR-CLIP	20371350
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	22012620
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT508850	hsa-miR-1272	PAR-CLIP	23446348
MIRT508850	hsa-miR-1272	PAR-CLIP	22012620
MIRT508850	hsa-miR-1272	PAR-CLIP	20371350
MIRT508851	hsa-miR-580-5p	PAR-CLIP	23446348
MIRT508851	hsa-miR-580-5p	PAR-CLIP	22012620
MIRT508851	hsa-miR-580-5p	PAR-CLIP	20371350
MIRT508852	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT508852	hsa-miR-224-5p	PAR-CLIP	22012620
MIRT508852	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT560191	hsa-miR-765	PAR-CLIP	20371350
MIRT560192	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT560193	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT560194	hsa-miR-4786-3p	PAR-CLIP	20371350
MIRT560195	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT560196	hsa-miR-3173-3p	PAR-CLIP	20371350

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005245	Function	Voltage-gated calcium channel activity	IBA	21873635
GO:0005245	Function	Voltage-gated calcium channel activity	NAS	11170751
GO:0005246	Function	Calcium channel regulator activity	IDA	21127204
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005769	Component	Early endosome	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005891	Component	Voltage-gated calcium channel complex	NAS	11170751
GO:0006816	Process	Calcium ion transport	NAS	11170751
GO:0016247	Function	Channel regulator activity	IBA	21873635
GO:0019226	Process	Transmission of nerve impulse	IBA	21873635
GO:0032281	Component	AMPA glutamate receptor complex	IBA	21873635
GO:0032281	Component	AMPA glutamate receptor complex	ISS
GO:0043025	Component	Neuronal cell body	IEA
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0044300	Component	Cerebellar mossy fiber	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IBA	21873635
GO:0061337	Process	Cardiac conduction	TAS
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0098839	Component	Postsynaptic density membrane	IBA	21873635
GO:0098943	Process	Neurotransmitter receptor transport, postsynaptic endosome to lysosome	IBA	21873635
GO:0098970	Process	Postsynaptic neurotransmitter receptor diffusion trapping	IBA	21873635
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099061	Component	Integral component of postsynaptic density membrane	IEA
GO:0099590	Process	Neurotransmitter receptor internalization	IBA	21873635
GO:1903861	Process	Positive regulation of dendrite extension	IEA
GO:1990454	Component	L-type voltage-gated calcium channel complex	IDA	21127204
GO:2000311	Process	Regulation of AMPA receptor activity	IBA	21873635
GO:2000311	Process	Regulation of AMPA receptor activity	IDA	21172611

Other IDs

• MIM: 606899
• HGNC: 13626
• e!Ensembl: ENSG00000105605

Protein

• UniProt ID: P62955
• Protein name: Voltage-dependent calcium channel gamma-7 subunit (Neuronal voltage-gated calcium channel gamma-7 subunit) (Transmembrane AMPAR regulatory protein gamma-7) (TARP gamma-7)
• Protein function: Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit (PubMed:21127204). Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Displays subunit-specific AMPA receptor regulation. Shows specificity only for GRIA1 and GRIA2 (PubMed:21172611).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13903	Claudin_2	18 → 197	PMP-22/EMP/MP20/Claudin tight junction	Family

• Sequence:

  MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
  VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
  GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
  FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
  RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC

• Sequence length: 275