CACNG6 (calcium voltage-gated channel auxiliary subunit gamma 6)

Gene

• Entrez ID: 59285
• Gene name: Calcium voltage-gated channel auxiliary subunit gamma 6
• Gene symbol: CACNG6
• Synonyms: -
• Chromosome: 19
• Chromosome location: 19q13.42
• Summary: Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members that function as transmembrane AMPA receptor regulatory proteins (TARPs). Alternative splicing results in multiple transcript variants. Variants in this gene have been associated with aspirin-intolerant asthma. [provided by RefSeq, Dec 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT650157	hsa-miR-2053	HITS-CLIP	23824327
MIRT650158	hsa-miR-5100	HITS-CLIP	23824327
MIRT650159	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT650160	hsa-miR-1288-5p	HITS-CLIP	23824327
MIRT650161	hsa-miR-4733-5p	HITS-CLIP	23824327
MIRT650162	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT650163	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT650164	hsa-miR-3606-3p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005245	Function	Voltage-gated calcium channel activity	NAS	11170751
GO:0005246	Function	Calcium channel regulator activity	IBA	21873635
GO:0005246	Function	Calcium channel regulator activity	IDA	21127204
GO:0005886	Component	Plasma membrane	TAS
GO:0005891	Component	Voltage-gated calcium channel complex	NAS	11170751
GO:0006816	Process	Calcium ion transport	NAS	11170751
GO:0061337	Process	Cardiac conduction	TAS
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	IBA	21873635
GO:1990454	Component	L-type voltage-gated calcium channel complex	IBA	21873635
GO:1990454	Component	L-type voltage-gated calcium channel complex	IDA	21127204

Other IDs

• MIM: 606898
• HGNC: 13625
• e!Ensembl: ENSG00000130433

Protein

• UniProt ID: Q9BXT2
• Protein name: Voltage-dependent calcium channel gamma-6 subunit (Neuronal voltage-gated calcium channel gamma-6 subunit)
• Protein function: Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13903	Claudin_2	47 → 241	PMP-22/EMP/MP20/Claudin tight junction	Family

• Sequence:

  MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTE
  FWVELNTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFF
  TTGENARIFQRTTKKEVNLAAAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGL
  SGLLLLVSLEVFRHSVRALLQRVSPEPPPAPRLTYEYSWSLGCGVGAGLILLLGAGCFLL
  LTLPSWPWGSLCPKRGHRAT

• Sequence length: 260