CACNG5 (calcium voltage-gated channel auxiliary subunit gamma 5)

Gene

• Entrez ID: 27091
• Gene name: Calcium voltage-gated channel auxiliary subunit gamma 5
• Gene symbol: CACNG5
• Synonyms: -
• Chromosome: 17
• Chromosome location: 17q24.2
• Summary: The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members, a type I TARP and a calcium channel gamma subunit. This gene is a susceptibility locus for schizophrenia and bipolar disorder. [provided by RefSeq, Dec 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025910	hsa-miR-7-5p	Microarray	17612493

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005245	Function	Voltage-gated calcium channel activity	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0014069	Component	Postsynaptic density	ISS
GO:0015075	Function	Ion transmembrane transporter activity	TAS	10613843
GO:0016247	Function	Channel regulator activity	IBA	21873635
GO:0019226	Process	Transmission of nerve impulse	IBA	21873635
GO:0032281	Component	AMPA glutamate receptor complex	IBA	21873635
GO:0032281	Component	AMPA glutamate receptor complex	ISS
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IBA	21873635
GO:0061337	Process	Cardiac conduction	TAS
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0098839	Component	Postsynaptic density membrane	IBA	21873635
GO:0098943	Process	Neurotransmitter receptor transport, postsynaptic endosome to lysosome	IBA	21873635
GO:0098962	Process	Regulation of postsynaptic neurotransmitter receptor activity	IMP	18817736
GO:0098970	Process	Postsynaptic neurotransmitter receptor diffusion trapping	IBA	21873635
GO:0098978	Component	Glutamatergic synapse	IMP	18817736
GO:0099055	Component	Integral component of postsynaptic membrane	IEA
GO:0099590	Process	Neurotransmitter receptor internalization	IBA	21873635
GO:2000311	Process	Regulation of AMPA receptor activity	IBA	21873635
GO:2000311	Process	Regulation of AMPA receptor activity	ISS

Other IDs

• MIM: 606405
• HGNC: 1409
• e!Ensembl: ENSG00000075429

Protein

• UniProt ID: Q9UF02
• Protein name: Voltage-dependent calcium channel gamma-5 subunit (Neuronal voltage-gated calcium channel gamma-5 subunit) (Transmembrane AMPAR regulatory protein gamma-5) (TARP gamma-5)
• Protein function: Regulates the gating properties of AMPA-selective glutamate receptors (AMPARs). Modulates their gating properties by accelerating their rates of activation, deactivation and desensitization. Displays subunit-specific AMPA receptor regulation. Shows specificity for GRIA1, GRIA4 and the long isoform of GRIA2. Thought to stabilize the calcium channel in an inactivated (closed) state (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00822	PMP22_Claudin	7 → 196	PMP-22/EMP/MP20/Claudin family	Family

• Sequence:

  MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWR
  VCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNI
  GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFA
  FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
  RSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC

• Sequence length: 275