CACNG4 (calcium voltage-gated channel auxiliary subunit gamma 4)

Gene

• Entrez ID: 27092
• Gene name: Calcium voltage-gated channel auxiliary subunit gamma 4
• Gene symbol: CACNG4
• Synonyms: -
• Chromosome: 17
• Chromosome location: 17q24.2
• Summary: The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members, a type II TARP and a calcium channel gamma subunit. [provided by RefSeq, Dec 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017598	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005245	Function	Voltage-gated calcium channel activity	IBA	21873635
GO:0005246	Function	Calcium channel regulator activity	IDA	21127204
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	10613843
GO:0009986	Component	Cell surface	IEA
GO:0016247	Function	Channel regulator activity	IBA	21873635
GO:0019226	Process	Transmission of nerve impulse	IBA	21873635
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0032281	Component	AMPA glutamate receptor complex	IBA	21873635
GO:0032281	Component	AMPA glutamate receptor complex	ISS
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0036477	Component	Somatodendritic compartment	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0044297	Component	Cell body	IEA
GO:0051899	Process	Membrane depolarization	TAS
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IBA	21873635
GO:0061337	Process	Cardiac conduction	TAS
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0098839	Component	Postsynaptic density membrane	IBA	21873635
GO:0098943	Process	Neurotransmitter receptor transport, postsynaptic endosome to lysosome	IBA	21873635
GO:0098962	Process	Regulation of postsynaptic neurotransmitter receptor activity	IEA
GO:0098970	Process	Postsynaptic neurotransmitter receptor diffusion trapping	IBA	21873635
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099061	Component	Integral component of postsynaptic density membrane	IEA
GO:0099590	Process	Neurotransmitter receptor internalization	IBA	21873635
GO:1990454	Component	L-type voltage-gated calcium channel complex	IDA	21127204
GO:2000311	Process	Regulation of AMPA receptor activity	IBA	21873635
GO:2000311	Process	Regulation of AMPA receptor activity	IDA	21172611
GO:2000969	Process	Positive regulation of AMPA receptor activity	IEA

Other IDs

• MIM: 606404
• HGNC: 1408
• e!Ensembl: ENSG00000075461

Protein

• UniProt ID: Q9UBN1
• Protein name: Voltage-dependent calcium channel gamma-4 subunit (Neuronal voltage-gated calcium channel gamma-4 subunit) (Transmembrane AMPAR regulatory protein gamma-4) (TARP gamma-4)
• Protein function: Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit (PubMed:21127204). Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs), including GRIA1 and GRIA4. Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization (PubMed:21172611).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00822	PMP22_Claudin	6 → 202	PMP-22/EMP/MP20/Claudin family	Family

• Sequence:

  MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGD
  LTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLL
  GGLCIGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYN
  YGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFLKASSSSPYARMPSYRYRR
  RRSRSSSRSTEASPSRDVSPMGLKITGAIPMGELSMYTLSREPLKVTTAASYSPDQEASF
  LQVHDFFQQDLKEGFHVSMLNRRTTPV

• Sequence length: 327