CACNG3 (calcium voltage-gated channel auxiliary subunit gamma 3)

Gene

• Entrez ID: 10368
• Gene name: Calcium voltage-gated channel auxiliary subunit gamma 3
• Gene symbol: CACNG3
• Synonyms: -
• Chromosome: 16
• Chromosome location: 16p12.1
• Summary: The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029027	hsa-miR-26b-5p	Microarray	19088304
MIRT858069	hsa-miR-299-3p	CLIP-seq
MIRT858070	hsa-miR-3117-3p	CLIP-seq
MIRT858071	hsa-miR-3169	CLIP-seq
MIRT858072	hsa-miR-3184	CLIP-seq
MIRT858073	hsa-miR-423-5p	CLIP-seq
MIRT858074	hsa-miR-432	CLIP-seq
MIRT858075	hsa-miR-4443	CLIP-seq
MIRT858076	hsa-miR-4446-3p	CLIP-seq
MIRT858077	hsa-miR-4648	CLIP-seq
MIRT858078	hsa-miR-4654	CLIP-seq
MIRT858079	hsa-miR-4656	CLIP-seq
MIRT858080	hsa-miR-4668-5p	CLIP-seq
MIRT858081	hsa-miR-4710	CLIP-seq
MIRT858082	hsa-miR-4721	CLIP-seq
MIRT858083	hsa-miR-4759	CLIP-seq
MIRT858084	hsa-miR-4769-5p	CLIP-seq
MIRT858085	hsa-miR-890	CLIP-seq
MIRT858082	hsa-miR-4721	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005245	Function	Voltage-gated calcium channel activity	IBA	21873635
GO:0005245	Function	Voltage-gated calcium channel activity	NAS	10221464
GO:0005886	Component	Plasma membrane	TAS
GO:0005891	Component	Voltage-gated calcium channel complex	NAS	10221464
GO:0006605	Process	Protein targeting	ISS
GO:0006816	Process	Calcium ion transport	NAS	10221464
GO:0008104	Process	Protein localization	ISS
GO:0016247	Function	Channel regulator activity	IBA	21873635
GO:0019226	Process	Transmission of nerve impulse	IBA	21873635
GO:0030165	Function	PDZ domain binding	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0032281	Component	AMPA glutamate receptor complex	IBA	21873635
GO:0032281	Component	AMPA glutamate receptor complex	ISS
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0036477	Component	Somatodendritic compartment	ISS
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IBA	21873635
GO:0060076	Component	Excitatory synapse	IEA
GO:0061337	Process	Cardiac conduction	TAS
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IBA	21873635
GO:0098943	Process	Neurotransmitter receptor transport, postsynaptic endosome to lysosome	IBA	21873635
GO:0098970	Process	Postsynaptic neurotransmitter receptor diffusion trapping	IBA	21873635
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099061	Component	Integral component of postsynaptic density membrane	IEA
GO:0099590	Process	Neurotransmitter receptor internalization	IBA	21873635
GO:2000311	Process	Regulation of AMPA receptor activity	IBA	21873635
GO:2000311	Process	Regulation of AMPA receptor activity	ISS
GO:2000969	Process	Positive regulation of AMPA receptor activity	IEA

Other IDs

• MIM: 606403
• HGNC: 1407
• e!Ensembl: ENSG00000006116

Protein

• UniProt ID: O60359
• Protein name: Voltage-dependent calcium channel gamma-3 subunit (Neuronal voltage-gated calcium channel gamma-3 subunit) (Transmembrane AMPAR regulatory protein gamma-3) (TARP gamma-3)
• Protein function: Regulates the trafficking to the somatodendritic compartment and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00822	PMP22_Claudin	6 → 196	PMP-22/EMP/MP20/Claudin family	Family

• Sequence:

  MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
  SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
  CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
  FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST
  EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK
  ESLHNNPANRRTTPV

• Sequence length: 315