CACNG1 (calcium voltage-gated channel auxiliary subunit gamma 1)

Gene

• Entrez ID: 786
• Gene name: Calcium voltage-gated channel auxiliary subunit gamma 1
• Gene symbol: CACNG1
• Synonyms: CACNLG
• Chromosome: 17
• Chromosome location: 17q24.2
• Summary: Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members that function as transmembrane AMPA receptor regulatory proteins (TARPs). [provided by RefSeq, Dec 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016792	hsa-miR-335-5p	Microarray	18185580
MIRT519336	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT519336	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT519337	hsa-miR-5010-3p	PAR-CLIP	23446348
MIRT519337	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT519338	hsa-miR-2113	PAR-CLIP	23446348
MIRT519338	hsa-miR-2113	PAR-CLIP	20371350
MIRT519339	hsa-miR-6855-5p	PAR-CLIP	23446348
MIRT519340	hsa-miR-3170	PAR-CLIP	23446348
MIRT519341	hsa-miR-4775	PAR-CLIP	23446348
MIRT519341	hsa-miR-4775	PAR-CLIP	20371350
MIRT519342	hsa-miR-633	PAR-CLIP	23446348
MIRT519342	hsa-miR-633	PAR-CLIP	20371350
MIRT519343	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT519344	hsa-miR-1273f	PAR-CLIP	23446348
MIRT519344	hsa-miR-1273f	PAR-CLIP	20371350
MIRT519345	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT519345	hsa-miR-4735-5p	PAR-CLIP	20371350
MIRT519346	hsa-miR-3976	PAR-CLIP	23446348
MIRT519346	hsa-miR-3976	PAR-CLIP	20371350
MIRT519347	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT519347	hsa-miR-6890-5p	PAR-CLIP	20371350
MIRT519348	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT519348	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT564503	hsa-miR-4282	PAR-CLIP	20371350

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005245	Function	Voltage-gated calcium channel activity	IEA
GO:0005246	Function	Calcium channel regulator activity	IBA	21873635
GO:0005246	Function	Calcium channel regulator activity	ISS
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	ISS
GO:0030315	Component	T-tubule	ISS
GO:0042383	Component	Sarcolemma	ISS
GO:0061337	Process	Cardiac conduction	TAS
GO:0070296	Process	Sarcoplasmic reticulum calcium ion transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	IBA	21873635
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	ISS
GO:1990454	Component	L-type voltage-gated calcium channel complex	IBA	21873635
GO:1990454	Component	L-type voltage-gated calcium channel complex	ISS

Other IDs

• MIM: 114209
• HGNC: 1405
• e!Ensembl: ENSG00000108878

Protein

• UniProt ID: Q06432
• Protein name: Voltage-dependent calcium channel gamma-1 subunit (Dihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma)
• Protein function: Regulatory subunit of the voltage-gated calcium channel that gives rise to L-type calcium currents in skeletal muscle. Regulates channel inactivation kinetics.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13903	Claudin_2	17 → 201	PMP-22/EMP/MP20/Claudin tight junction	Family

• Sequence:

  MSQTKMLKVRVTLFCILAGIVLAMTAVVTDHWAVLSPHMEHHNTTCEAAHFGLWRICTKR
  IPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIL
  GSLCVLLSLGKKRDYLLRPASMFYAFAGLCILVSVEVMRQSVKRMIDSEDTVWIEYYYSW
  SFACACAAFILLFLGGLALLLFSLPRMPRNPWESCMDAEPEH

• Sequence length: 222