CACNB3 (calcium voltage-gated channel auxiliary subunit beta 3)

Gene

• Entrez ID: 784
• Gene name: Calcium voltage-gated channel auxiliary subunit beta 3
• Gene symbol: CACNB3
• Synonyms: CAB3, CACNLB3
• Chromosome: 12
• Chromosome location: 12q13.12
• Summary: This gene encodes a regulatory beta subunit of the voltage-dependent calcium channel. Beta subunits are composed of five domains, which contribute to the regulation of surface expression and gating of calcium channels and may also play a role in the regulation of transcription factors and calcium transport. [provided by RefSeq, Oct 2011]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016710	hsa-miR-335-5p	Microarray	18185580
MIRT042695	hsa-miR-196b-5p	CLASH	23622248
MIRT732534	hsa-miR-34a-5p	Immunocytochemistry, Luciferase reporter assay, Western blot	25623948

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005245	Function	Voltage-gated calcium channel activity	IDA	11160515
GO:0005246	Function	Calcium channel regulator activity	ISS
GO:0005515	Function	Protein binding	IPI	18535142, 32296183
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0005891	Component	Voltage-gated calcium channel complex	IBA	21873635
GO:0005891	Component	Voltage-gated calcium channel complex	IDA	11160515
GO:0006816	Process	Calcium ion transport	IDA	11160515
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007528	Process	Neuromuscular junction development	IBA	21873635
GO:0008331	Function	High voltage-gated calcium channel activity	IBA	21873635
GO:0008331	Function	High voltage-gated calcium channel activity	ISS	25527503
GO:0016020	Component	Membrane	IDA	16525042
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0051899	Process	Membrane depolarization	TAS
GO:0060402	Process	Calcium ion transport into cytosol	ISS	25527503
GO:0061337	Process	Cardiac conduction	TAS
GO:0061577	Process	Calcium ion transmembrane transport via high voltage-gated calcium channel	ISS	25527503
GO:0072659	Process	Protein localization to plasma membrane	ISS	25527503
GO:0090314	Process	Positive regulation of protein targeting to membrane	IEA
GO:0090650	Process	Cellular response to oxygen-glucose deprivation	IEA
GO:0098903	Process	Regulation of membrane repolarization during action potential	ISS	25527503
GO:1901385	Process	Regulation of voltage-gated calcium channel activity	IBA	21873635
GO:1901386	Process	Negative regulation of voltage-gated calcium channel activity	IEA
GO:1901843	Process	Positive regulation of high voltage-gated calcium channel activity	ISS
GO:1902630	Process	Regulation of membrane hyperpolarization	IEA
GO:1905788	Process	Negative regulation of detection of mechanical stimulus involved in sensory perception of touch	IEA
GO:1990454	Component	L-type voltage-gated calcium channel complex	ISS	25527503
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	IEA

Other IDs

• MIM: 601958
• HGNC: 1403
• e!Ensembl: ENSG00000167535

Protein

• UniProt ID: P54284
• Protein name: Voltage-dependent L-type calcium channel subunit beta-3 (CAB3) (Calcium channel voltage-dependent subunit beta 3)
• Protein function: Regulatory subunit of the voltage-gated calcium channel that gives rise to L-type calcium currents (PubMed:8119293). Increases CACNA1B peak calcium current and shifts the voltage dependencies of channel activation and inactivation (By similarity). Increases CACNA1C peak calcium current and shifts the voltage dependencies of channel activation and inactivation (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12052	VGCC_beta4Aa_N	16 → 58	Voltage gated calcium channel subunit beta domain 4Aa N terminal	Domain
  PF00625	Guanylate_kin	176 → 356	Guanylate kinase	Domain

• Sequence:

  MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPV
  AFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPS
  PQRLESIRLKQEQKARRSGNPSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPV
  VLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIER
  SSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVL
  QRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRAT
  HHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQR
  SSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWP
  KDSY

• Sequence length: 484