C5AR1 (complement C5a receptor 1)

Gene

• Entrez ID: 728
• Gene name: Complement C5a receptor 1
• Gene symbol: C5AR1
• Synonyms: C5A, C5AR, C5R1, CD88
• Chromosome: 19
• Chromosome location: 19q13.32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019124	hsa-miR-335-5p	Microarray	18185580
MIRT030190	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	TAS	7649993
GO:0001774	Process	Microglial cell activation	ISS
GO:0001856	Function	Complement component C5a binding	IEA
GO:0002430	Process	Complement receptor mediated signaling pathway	IBA	21873635
GO:0004875	Function	Complement receptor activity	IBA	21873635
GO:0004878	Function	Complement component C5a receptor activity	IBA	21873635
GO:0004878	Function	Complement component C5a receptor activity	IDA	10571060, 22496247
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004930	Function	G protein-coupled receptor activity	IPI	10571060
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	2007135
GO:0006915	Process	Apoptotic process	IEA
GO:0006935	Process	Chemotaxis	TAS	10352266
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006955	Process	Immune response	TAS	9590258
GO:0006968	Process	Cellular defense response	TAS	8779720
GO:0007165	Process	Signal transduction	TAS	2007135, 8702752
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007202	Process	Activation of phospholipase C activity	TAS	7649993
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0007606	Process	Sensory perception of chemical stimulus	TAS	9590258
GO:0009986	Component	Cell surface	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IEA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	22960554
GO:0021534	Process	Cell proliferation in hindbrain	IEA
GO:0030449	Process	Regulation of complement activation	TAS
GO:0030593	Process	Neutrophil chemotaxis	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031100	Process	Animal organ regeneration	IEA
GO:0032494	Process	Response to peptidoglycan	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0038178	Process	Complement component C5a signaling pathway	IDA	10571060
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	22496247
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045177	Component	Apical part of cell	IDA	22496247
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0048143	Process	Astrocyte activation	ISS
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IDA	22496247
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050890	Process	Cognition	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	22496247
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0097242	Process	Amyloid-beta clearance	ISS
GO:0099172	Process	Presynapse organization	ISS
GO:1902947	Process	Regulation of tau-protein kinase activity	ISS

Other IDs

• MIM: 113995
• HGNC: 1338
• e!Ensembl: ENSG00000197405

Protein

• UniProt ID: P21730
• Protein name: C5a anaphylatoxin chemotactic receptor 1 (C5a anaphylatoxin chemotactic receptor) (C5a-R) (C5aR) (CD antigen CD88)
• Protein function: Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a (PubMed:1847994, PubMed:8182049, PubMed:7622471, PubMed:9553099, PubMed:10636859, PubMed:15153520, PubMed:29300009). The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region which activates downstream signaling events (PubMed:8182049, PubMed:7622471, PubMed:9553099). Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production (PubMed:10636859, PubMed:15153520).
• PDB: 5O9H, 6C1Q, 6C1R
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	54 → 300	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
  VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
  YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
  YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
  LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
  VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

• Sequence length: 350