C3AR1 (complement C3a receptor 1)

Gene

• Entrez ID: 719
• Gene name: Complement C3a receptor 1
• Gene symbol: C3AR1
• Synonyms: AZ3B, C3AR, HNFAG09
• Chromosome: 12
• Chromosome location: 12p13.31
• Summary: C3a is an anaphylatoxin released during activation of the complement system. The protein encoded by this gene is an orphan G protein-coupled receptor for C3a. Binding of C3a by the encoded receptor activates chemotaxis, granule enzyme release, superoxide anion production, and bacterial opsonization. [provided by RefSeq, May 2016]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs869312973	->TC	Likely-pathogenic	Coding sequence variant, frameshift variant

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002430	Process	Complement receptor mediated signaling pathway	IBA	21873635
GO:0002430	Process	Complement receptor mediated signaling pathway	IDA	10571060
GO:0004875	Function	Complement receptor activity	IBA	21873635
GO:0004876	Function	Complement component C3a receptor activity	IBA	21873635
GO:0004876	Function	Complement component C3a receptor activity	IDA	10571060
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004930	Function	G protein-coupled receptor activity	IPI	10571060
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	8702752
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0008015	Process	Blood circulation	TAS	8765043
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IEA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IEA
GO:0030449	Process	Regulation of complement activation	TAS
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0035579	Component	Specific granule membrane	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0051482	Process	Positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IPI	10571060
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA

Other IDs

• MIM: 605246
• HGNC: 1319
• e!Ensembl: ENSG00000171860

Protein

• UniProt ID: Q16581
• Protein name: C3a anaphylatoxin chemotactic receptor (C3AR) (C3a-R)
• Protein function: Receptor for the chemotactic and inflammatory peptide anaphylatoxin C3a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	40 → 184	7 transmembrane receptor (rhodopsin family)	Family
  PF00001	7tm_1	318 → 435	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIW
  FLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDR
  CLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSS
  SLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSAD
  SLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSA
  SSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIV
  FRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVC
  IALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNST
  TV

• Sequence length: 482