BCL2A1 (BCL2 related protein A1)

Gene

• Entrez ID: 597
• Gene name: BCL2 related protein A1
• Gene symbol: BCL2A1
• Synonyms: ACC-1, ACC-2, ACC1, ACC2, BCL2L5, BFL1, GRS, HBPA1
• Chromosome: 15
• Chromosome location: 15q25.1
• Summary: This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeosta

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017218	hsa-miR-335-5p	Microarray	18185580
MIRT021264	hsa-miR-146a-5p	Microarray	18057241
MIRT818591	hsa-miR-182	CLIP-seq
MIRT818592	hsa-miR-3074-3p	CLIP-seq
MIRT818593	hsa-miR-4704-3p	CLIP-seq
MIRT818594	hsa-miR-587	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HDAC1	Activation	17000776
MITF	Repression	23447565
NFKB1	Activation	11880364;12665576;19343319
NFKB1	Unknown	10733571;17000776
REL	Activation	11880364
RELA	Activation	11880364;19343319
RELA	Unknown	10733571;17000776

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	10753914, 16697956, 17428862, 25416956, 31515488, 32296183
GO:0005741	Component	Mitochondrial outer membrane	IBA	21873635
GO:0007568	Process	Aging	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA	21873635
GO:0021987	Process	Cerebral cortex development	IEA
GO:0042803	Function	Protein homodimerization activity	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IBA	21873635
GO:0051400	Function	BH domain binding	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IBA	21873635

Other IDs

• MIM: 601056
• HGNC: 991
• e!Ensembl: ENSG00000140379

Protein

• UniProt ID: Q16548
• Protein name: Bcl-2-related protein A1 (Bcl-2-like protein 5) (Bcl2-L-5) (Hemopoietic-specific early response protein) (Protein BFL-1) (Protein GRS)
• Protein function: Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection (By similarity). Can inhibit apoptosis induced by serum starvation in t
• PDB: 2VM6, 3I1H, 3MQP, 4ZEQ, 5UUK, 5UUL, 5UUP, 5WHH, 5WHI, 6E3I, 6E3J, 6MBB, 6MBC, 6RJP, 6VO4, 8RPO, 9FKY, 9FKZ, 9FL0, 9GIP, 9GIQ, 9GIR, 9GIS, 9GIT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00452	Bcl-2	37 → 140	Apoptosis regulator proteins, Bcl-2 family	Family

• Sequence:

  MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
  VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
  FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC

• Sequence length: 175