BCL2A1 (BCL2 related protein A1)

Gene

• Entrez ID: 597
• Gene name: BCL2 related protein A1
• Gene symbol: BCL2A1
• Synonyms: ACC-1, ACC-2, ACC1, ACC2, BCL2L5, BFL1, GRS, HBPA1
• Chromosome: 15
• Chromosome location: 15q25.1
• Summary: This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and is up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017218	hsa-miR-335-5p	Microarray	18185580
MIRT021264	hsa-miR-146a-5p	Microarray	18057241
MIRT734010	hsa-miR-34a-5p	PCR array	28097098

Transcription factors

Transcription factor	Regulation	Reference
HDAC1	Activation	17000776
MITF	Repression	23447565
NFKB1	Activation	11880364;12665576;19343319
NFKB1	Unknown	10733571;17000776
REL	Activation	11880364
RELA	Activation	11880364;19343319
RELA	Unknown	10733571;17000776

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	10753914, 16697956, 17428862, 25416956, 31515488, 32296183
GO:0005741	Component	Mitochondrial outer membrane	IBA	21873635
GO:0007568	Process	Aging	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA	21873635
GO:0021987	Process	Cerebral cortex development	IEA
GO:0042803	Function	Protein homodimerization activity	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IBA	21873635
GO:0051400	Function	BH domain binding	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IBA	21873635

Other IDs

• MIM: 601056
• HGNC: 991
• e!Ensembl: ENSG00000140379

Protein

• UniProt ID: Q16548
• Protein name: Bcl-2-related protein A1 (Bcl-2-like protein 5) (Bcl2-L-5) (Hemopoietic-specific early response protein) (Protein BFL-1) (Protein GRS)
• Protein function: Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection (By similarity). Can inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11 (By similarity).
• PDB: 2VM6, 3I1H, 3MQP, 4ZEQ, 5UUK, 5UUL, 5UUP, 5WHH, 5WHI, 6E3I, 6E3J, 6MBB, 6MBC, 6RJP, 6VO4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00452	Bcl-2	37 → 140	Apoptosis regulator proteins, Bcl-2 family	Family

• Sequence:

  MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
  VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
  FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC

• Sequence length: 175