GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

BCL2 (BCL2 apoptosis regulator)

Gene

596

BCL2 apoptosis regulator

BCL2

Bcl-2, PPP1R50

18q21.33

This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

Show/Hide all(161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000065	hsa-miR-34b-5p	Luciferase reporter assay, qRT-PCR, Western blot	18803879
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay	17072344
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay, Western blot	21376256
MIRT000159	hsa-miR-21-5p	qRT-PCR, Western blot	22528454
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay	22710123
MIRT000159	hsa-miR-21-5p	Western blot	21468550
MIRT000159	hsa-miR-21-5p	Western blot;Other	20048743
MIRT000159	hsa-miR-21-5p	ChIP-seq, Immunofluorescence, Western blot	24606718
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay, Western blot	25327529
MIRT000192	hsa-miR-204-5p	Luciferase reporter assay	19074899
MIRT000192	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	22892391
MIRT000192	hsa-miR-204-5p	Immunohistochemistry, Microarray, qRT-PCR, Western blot	23152059
MIRT000192	hsa-miR-204-5p	qRT-PCR, Western blot	24960059
MIRT000192	hsa-miR-204-5p	Luciferase reporter assay, Western blot	28280358
MIRT000192	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	27519795
MIRT000290	hsa-miR-153-3p	Luciferase reporter assay, Western blot, Reporter assay	19676043
MIRT000418	hsa-let-7a-5p	Microarray, qRT-PCR	17260024
MIRT000815	hsa-miR-15a-5p	qRT-PCR, proteomics analysis	18362358
MIRT000815	hsa-miR-15a-5p	Luciferase reporter assay	17707831
MIRT000815	hsa-miR-15a-5p	Luciferase reporter assay	19478946
MIRT000815	hsa-miR-15a-5p	Western blot	20876285
MIRT000815	hsa-miR-15a-5p	Microarray, qRT-PCR	17260024
MIRT000815	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	16166262
MIRT000815	hsa-miR-15a-5p	Western blot	19903841
MIRT000815	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT000815	hsa-miR-15a-5p	Western blot	26397135
MIRT000978	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot, Reporter assay, Reporter assay;Other	18449891
MIRT000978	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	23907579
MIRT000978	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT000978	hsa-miR-15b-5p	qRT-PCR, Western blot	26884837
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17877811
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot, Reporter assay	18449891
MIRT001800	hsa-miR-16-5p	qRT-PCR, proteomics analysis	18362358
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17351108
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17707831
MIRT001800	hsa-miR-16-5p	Immunohistochemistry, Microarray, Western blot	20643754
MIRT001800	hsa-miR-16-5p	Western blot	20876285
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay, Western blot	19269153
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	16166262
MIRT001800	hsa-miR-16-5p	Western blot	19903841
MIRT001800	hsa-miR-16-5p	Sequencing	20371350
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	23907579
MIRT001800	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT001800	hsa-miR-16-5p	Western blot	24148817
MIRT001800	hsa-miR-16-5p	Immunoprecipitaion, qRT-PCR, Immunoblot, Western blot	25435430
MIRT001800	hsa-miR-16-5p	Western blot	26397135
MIRT001800	hsa-miR-16-5p	Microarray, qRT-PCR, Western blot	26722459
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	18803879
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot, Reporter assay;Western blot;qRT-PCR;Other	19683563
MIRT002298	hsa-miR-34a-5p	qRT-PCR, Western blot, Luciferase reporter assay	18505919
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	19461653
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay, Western blot, Microarray	17914404
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay, Microarray, Western blot	17656095
MIRT002298	hsa-miR-34a-5p	Flow, Immunoblot, Luciferase reporter assay, Reporter assay	20598588
MIRT002298	hsa-miR-34a-5p	Reporter assay;Other	21399894
MIRT002298	hsa-miR-34a-5p	Proteomics	21566225
MIRT002298	hsa-miR-34a-5p	qRT-PCR, Western blot	24565525
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	23862748
MIRT002298	hsa-miR-34a-5p	qRT-PCR	23292172
MIRT002298	hsa-miR-34a-5p	qRT-PCR	26802970
MIRT002298	hsa-miR-34a-5p	qRT-PCR, Western blot	27939626
MIRT002298	hsa-miR-34a-5p	Flow, QRTPCR, Western blot	26406332
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25910896
MIRT003011	hsa-miR-20a-5p	Luciferase reporter assay	19666108
MIRT003014	hsa-miR-17-5p	Luciferase reporter assay	19666108
MIRT003014	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	24280866
MIRT003289	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	20041405
MIRT003289	hsa-miR-29c-3p	Luciferase reporter assay	23894561
MIRT003290	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	20041405
MIRT003290	hsa-miR-29b-3p	Luciferase reporter assay	23894561
MIRT003290	hsa-miR-29b-3p	qRT-PCR	25006537
MIRT003291	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	20041405
MIRT003291	hsa-miR-29a-3p	qRT-PCR	25006537
MIRT003449	hsa-miR-34b-3p	qRT-PCR, Western blot	24960059
MIRT003498	hsa-miR-181d-5p	Luciferase reporter assay, qRT-PCR, Western blot, Reporter assay;Western blot;Other	20162574
MIRT003498	hsa-miR-181d-5p	FACS, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22207524
MIRT003499	hsa-miR-181c-5p	Luciferase reporter assay, qRT-PCR, Western blot, Reporter assay;Western blot;Other	20162574
MIRT003499	hsa-miR-181c-5p	GFP reporter assay, qRT-PCR, Western blot	25898913
MIRT003500	hsa-miR-181b-5p	Luciferase reporter assay, qRT-PCR, Western blot, Reporter assay;Western blot;Other	20162574
MIRT003500	hsa-miR-181b-5p	Luciferase reporter assay	22610076
MIRT003500	hsa-miR-181b-5p	ELISA, GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	23440261
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot, Reporter assay;Western blot;Other	20162574
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay	22285729
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22209977
MIRT003501	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21958558
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay	22610076
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24335172
MIRT003501	hsa-miR-181a-5p	Immunoblot, qRT-PCR, Western blot	24002437
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27802900
MIRT003979	hsa-miR-34c-5p	Luciferase reporter assay, qRT-PCR, Western blot	18803879
MIRT003979	hsa-miR-34c-5p	qRT-PCR, Western blot	24960059
MIRT003979	hsa-miR-34c-5p	Next Generation Sequencing (NGS), qRT-PCR, Western blot	26795575
MIRT003980	hsa-miR-33b-5p	qRT-PCR, Western blot	18803879
MIRT004844	hsa-miR-192-5p	Luciferase reporter assay, qRT-PCR, Reporter assay;Microarray;Other	19074876
MIRT004844	hsa-miR-192-5p	qRT-PCR, Western blot	26550150
MIRT005362	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	20727858
MIRT005362	hsa-miR-195-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23451060
MIRT005362	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT005362	hsa-miR-195-5p	qRT-PCR, Western blot	26064276
MIRT005578	hsa-miR-630	Immunoblot, Luciferase reporter assay, qRT-PCR	21274007
MIRT005744	hsa-miR-451a	qRT-PCR, Western blot	20816946
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assay, Western blot	22072615
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	22293115
MIRT006253	hsa-miR-125b-5p	ELISA, qRT-PCR	26057745
MIRT006445	hsa-miR-449a	ChIP-seq, Luciferase reporter assay	21569010
MIRT006445	hsa-miR-449a	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24248414
MIRT006445	hsa-miR-449a	Luciferase reporter assay, qRT-PCR, Western blot	24260067
MIRT006445	hsa-miR-449a	qRT-PCR, Western blot	24960059
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006670	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	21993663
MIRT006673	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21993663
MIRT006674	hsa-miR-429	Luciferase reporter assay, qRT-PCR, Western blot	21993663
MIRT006674	hsa-miR-429	Luciferase reporter assay, qRT-PCR, Western blot	26513239
MIRT006868	hsa-miR-136-5p	Luciferase reporter assay	22967897
MIRT006904	hsa-miR-7-5p	GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot, Reporter assay;Western blot;qRT-PCR;Other	21750649
MIRT006904	hsa-miR-7-5p	qRT-PCR, Western blot	26464649
MIRT006975	hsa-miR-148a-3p	Luciferase reporter assay	21455217
MIRT006977	hsa-miR-24-2-5p	Luciferase reporter assay	21463514
MIRT007063	hsa-miR-182-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22848417
MIRT007063	hsa-miR-182-5p	qRT-PCR	23936432
MIRT007146	hsa-miR-196b-5p	Immunocytochemistry	23293219
MIRT007348	hsa-miR-143-3p	Western blot	23276710
MIRT007348	hsa-miR-143-3p	Western blot	19843160
MIRT007348	hsa-miR-143-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22160209
MIRT007348	hsa-miR-143-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25492481
MIRT019975	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT024494	hsa-miR-215-5p	Microarray	19074876
MIRT027158	hsa-miR-103a-3p	Sequencing	20371350
MIRT027929	hsa-miR-96-5p	Sequencing	20371350
MIRT052936	hsa-miR-205-5p	Immunohistochemistry, qRT-PCR, Western blot	24297308
MIRT052936	hsa-miR-205-5p	Luciferase reporter assay, Western blot	23612742
MIRT052936	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	26397843
MIRT053253	hsa-miR-126-3p	In situ hybridization, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23603512
MIRT053297	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24280866
MIRT053471	hsa-miR-497-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21258880
MIRT053471	hsa-miR-497-5p	Luciferase reporter assay, qRT-PCR, Western blot	26339338
MIRT054926	hsa-miR-1915-3p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22121083
MIRT199194	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT199222	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT369727	hsa-miR-448	qRT-PCR, Western blot	24960059
MIRT387672	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26297542
MIRT437391	hsa-miR-708-5p	Flow, qRT-PCR, Western blot	23754151
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438196	hsa-miR-30b-5p	Luciferase reporter assay	24178239
MIRT438304	hsa-miR-135a-5p	Luciferase reporter assay, qRT-PCR,	25230140
MIRT438617	hsa-miR-224-5p	Microarray, qRT-PCR, Western blot	22989374
MIRT438662	hsa-miR-503-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	23856992
MIRT438662	hsa-miR-503-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24931256
MIRT438662	hsa-miR-503-5p	Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	28343379
MIRT438772	hsa-miR-494-3p	qRT-PCR, Western blot	24960059
MIRT438781	hsa-miR-211-5p	qRT-PCR, Western blot	24960059
MIRT732216	hsa-miR-9-5p	Luciferase reporter assay, Western blot	26660116
MIRT732232	hsa-miR-139-5p	Luciferase reporter assay, qRT-PCR, Western blot	27244080
MIRT733189	hsa-miR-26a-1-3p	qRT-PCR, Western blot	27517917
MIRT733312	hsa-miR-1284	qRT-PCR, Western blot	27627897
MIRT733663	hsa-miR-376c-3p	Flow, Immunohistochemistry, qRT-PCR, Western blot	27965982
MIRT733733	hsa-miR-190b	qRT-PCR, Western blot	28044223
MIRT735398	hsa-miR-15a-3p	qRT-PCR, Western blot	27596960
MIRT735399	hsa-miR-16-1-3p	qRT-PCR, Western blot	27596960
MIRT735452	hsa-miR-98-5p	Luciferase reporter assay, Western blot	27422937

Transcription factors

Show/Hide all(62)

Transcription factor	Regulation	Reference
ABL1	Repression	11753601
ATF1	Unknown	10542244
ATF5	Activation	21212266
ATM	Repression	16214353
BACH2	Unknown	18929412
CEBPA	Repression	12970736
CREB1	Activation	17290286
CREB1	Unknown	10542244;19626458
DDB2	Repression	20013802
DEK	Activation	17685435
E2F1	Activation	11559537;12679318
ERCC2	Repression	22387547
ESR1	Activation	19148464
ESR1	Unknown	10542244;11261829;9306964
FOXA1	Repression	19127412
GLI1	Activation	19074837;21135115
GLI1	Repression	14555646
GLI1	Unknown	15520176;24739390
GLI2	Activation	16880536;21135115
HOXA1	Activation	12482855;15665309
ING2	Repression	15748897
ING4	Repression	19895734;20707719
IRF1	Repression	10918594
MSX2	Repression	21730974
MYB	Activation	11675351
MYB	Repression	20659323
MYB	Unknown	16088151
MYC	Unknown	18809243
NCOA3	Activation	22213475
NFKB1	Activation	14978135;18158998;19259124;20446017;21503108
NFKB1	Repression	12032828;15120608;18031796;18566231
NFKB1	Unknown	14739605;16022909;16453001;17673602;18761399;19233129;20103608;20332461
NR1I2	Activation	16085054
PARP1	Repression	20564216
PAWR	Repression	11912153;9989812
PAX5	Repression	22105368
PER1	Activation	19675098
PGR	Activation	17785366
PGR	Unknown	9306964
PPARG	Activation	15067355
PPARG	Repression	14960510
RELA	Activation	14978135;18158998;19259124;20446017;21503108
RELA	Repression	15120608;18031796;18566231
RELA	Unknown	14739605;16022909;16453001;17673602;18761399;19233129;20103608;20332461
SATB1	Activation	20564216
SATB1	Unknown	21310710
SIM2	Repression	21729534
SMAD2	Unknown	24739390
SMAD4	Unknown	24739390
SP1	Unknown	10542244
STAT3	Activation	15184887;15805299;18839277;19926637;21435102;22504301
STAT3	Repression	22313388
STAT3	Unknown	18320073;20043094;20446017;21172343;21344490;21385902
TBP	Repression	11313951
TCF4	Unknown	23671559
TFAP2A	Repression	16533807
TP53	Repression	11313951;17693666;19411072;20428827;9000137
TP53	Unknown	21859835
TWIST1	Unknown	23095743
WT1	Unknown	12644474
ZBTB16	Repression	14769944
ZNRD1	Activation	16373708;16609701

Show/Hide all(145)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	16717086
GO:0001503	Process	Ossification	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001656	Process	Metanephros development	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001662	Process	Behavioral fear response	IEA
GO:0001782	Process	B cell homeostasis	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	ISS	9843949
GO:0001836	Process	Release of cytochrome c from mitochondria	NAS	9027314
GO:0001952	Process	Regulation of cell-matrix adhesion	IEA
GO:0002020	Function	Protease binding	IDA	10620603
GO:0002320	Process	Lymphoid progenitor cell differentiation	IEA
GO:0002326	Process	B cell lineage commitment	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003014	Process	Renal system process	IEA
GO:0005515	Function	Protein binding	IPI	7954800, 9305631, 9334338, 9388232, 9463381, 9660918, 9973195, 10837489, 11054413, 11060313, 11126360, 11278245, 11463391, 12624108, 12667443, 12901880, 14739602, 15694340, 15733859, 16697956, 16790527, 17074758, 17289999, 17418785, 17428862, 17446862, 17525735, 17692808, 18719108, 1
GO:0005634	Component	Nucleus	IDA	7546744, 7896880
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	7546744, 11530860
GO:0005739	Component	Mitochondrion	IDA	7896880, 9027314
GO:0005741	Component	Mitochondrial outer membrane	IBA	21873635
GO:0005741	Component	Mitochondrial outer membrane	IDA	8402648, 9027314
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005783	Component	Endoplasmic reticulum	IDA	8402648
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006470	Process	Protein dephosphorylation	IEA
GO:0006582	Process	Melanin metabolic process	IEA
GO:0006808	Process	Regulation of nitrogen utilization	IEA
GO:0006915	Process	Apoptotic process	IDA	36599, 8022822
GO:0006959	Process	Humoral immune response	TAS	1908951
GO:0006974	Process	Cellular response to DNA damage stimulus	IMP	17875758
GO:0007015	Process	Actin filament organization	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007565	Process	Female pregnancy	NAS	11530860
GO:0007569	Process	Cell aging	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	28280358
GO:0008584	Process	Male gonad development	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	10597216
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA	21873635
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0009314	Process	Response to radiation	NAS	15799693
GO:0009636	Process	Response to toxic substance	IDA	16307838, 16717086
GO:0009791	Process	Post-embryonic development	IEA
GO:0010039	Process	Response to iron ion	IDA	11264898
GO:0010224	Process	Response to UV-B	IEA
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010507	Process	Negative regulation of autophagy	TAS	18309324
GO:0010523	Process	Negative regulation of calcium ion transport into cytosol	IEA
GO:0010559	Process	Regulation of glycoprotein biosynthetic process	IEA
GO:0014031	Process	Mesenchymal cell development	IEA
GO:0014042	Process	Positive regulation of neuron maturation	IEA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0015267	Function	Channel activity	IDA	9219694
GO:0016020	Component	Membrane	IDA	7896880
GO:0016248	Function	Channel inhibitor activity	IDA	9219694
GO:0018105	Process	Peptidyl-serine phosphorylation	IEA
GO:0018107	Process	Peptidyl-threonine phosphorylation	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0021747	Process	Cochlear nucleus development	IEA
GO:0022612	Process	Gland morphogenesis	IEA
GO:0022898	Process	Regulation of transmembrane transporter activity	IDA	9219694
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030307	Process	Positive regulation of cell growth	IDA	8022822
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030318	Process	Melanocyte differentiation	IEA
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	IMP	17875758
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0031103	Process	Axon regeneration	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	20889974
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031965	Component	Nuclear membrane	IDA	1502141, 8402648
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	TAS	18309324
GO:0032835	Process	Glomerulus development	IEA
GO:0032848	Process	Negative regulation of cellular pH reduction	IDA	10506221
GO:0032991	Component	Protein-containing complex	IMP	15733859
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IEA
GO:0033689	Process	Negative regulation of osteoblast proliferation	IEA
GO:0034097	Process	Response to cytokine	IDA	9184696
GO:0035094	Process	Response to nicotine	IDA	12421819
GO:0035265	Process	Organ growth	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042100	Process	B cell proliferation	IDA	1373874
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0042493	Process	Response to drug	IDA	36599
GO:0042493	Process	Response to drug	IMP	17875758
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042802	Function	Identical protein binding	IPI	9111042, 9463381, 18835031
GO:0042803	Function	Protein homodimerization activity	IBA	21873635
GO:0043029	Process	T cell homeostasis	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	1373874, 7650367, 7772249, 8050499, 8080725, 9027314, 9219694, 10506221, 10620603, 15776018, 20041405
GO:0043066	Process	Negative regulation of apoptotic process	IGI	9660918, 28280358
GO:0043066	Process	Negative regulation of apoptotic process	IMP	7772249, 17289999, 21212266
GO:0043066	Process	Negative regulation of apoptotic process	TAS
GO:0043085	Process	Positive regulation of catalytic activity	IEA
GO:0043209	Component	Myelin sheath	IEA
GO:0043375	Process	CD8-positive, alpha-beta T cell lineage commitment	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	7546744
GO:0043565	Function	Sequence-specific DNA binding	IDA	12086670
GO:0043583	Process	Ear development	IEA
GO:0045069	Process	Regulation of viral genome replication	IEA
GO:0045636	Process	Positive regulation of melanocyte differentiation	IEA
GO:0046671	Process	Negative regulation of retinal cell programmed cell death	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	ISS	9843949
GO:0046930	Component	Pore complex	IDA	9219694
GO:0046982	Function	Protein heterodimerization activity	IBA	21873635
GO:0046982	Function	Protein heterodimerization activity	IPI	9111042
GO:0048041	Process	Focal adhesion assembly	IEA
GO:0048536	Process	Spleen development	IEA
GO:0048538	Process	Thymus development	IEA
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048599	Process	Oocyte development	IEA
GO:0048743	Process	Positive regulation of skeletal muscle fiber development	IEA
GO:0048753	Process	Pigment granule organization	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050853	Process	B cell receptor signaling pathway	IMP	17875758
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051402	Process	Neuron apoptotic process	TAS	16167175
GO:0051434	Function	BH3 domain binding	IPI	9111042
GO:0051607	Process	Defense response to virus	IDA	10620603
GO:0051721	Function	Protein phosphatase 2A binding	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	ISS	9843949
GO:0051902	Process	Negative regulation of mitochondrial depolarization	TAS	9027314
GO:0051924	Process	Regulation of calcium ion transport	IDA	8022822
GO:0055085	Process	Transmembrane transport	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	15776018
GO:0070491	Function	Repressing transcription factor binding	IPI	16443602
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IBA	21873635
GO:0098609	Process	Cell-cell adhesion	IEA
GO:1900740	Process	Positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	TAS	1286168
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IEA
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IEA
GO:2000811	Process	Negative regulation of anoikis	IMP	15006356
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IMP	20097879
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IGI	8358790
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IBA	21873635
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IDA	11684014
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	TAS

MIM	HGNC	e!Ensembl
151430	990	ENSG00000171791

Protein

UniProt ID

P10415

Protein name

Apoptosis regulator Bcl-2

Protein function

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed:17418785).

PDB

1G5M , 1GJH , 1YSW , 2O21 , 2O22 , 2O2F , 2W3L , 2XA0 , 4AQ3 , 4IEH , 4LVT , 4LXD , 4MAN , 5AGW , 5AGX , 5FCG , 5JSN , 5VAU , 5VAX , 5VAY , 6GL8 , 6IWB , 6O0K , 6O0L , 6O0M , 6O0O , 6O0P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02180	BH4	8 → 32	Bcl-2 homology region 4	Family
PF00452	Bcl-2	97 → 195	Apoptosis regulator proteins, Bcl-2 family	Family

Sequence

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Sequence length

239

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412