BCAT2 (branched chain amino acid transaminase 2)

Gene

• Entrez ID: 587
• Gene name: Branched chain amino acid transaminase 2
• Gene symbol: BCAT2
• Synonyms: BCAM, BCATM, BCT2, HVLI, PP18
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: This gene encodes a branched chain aminotransferase found in mitochondria. The encoded protein forms a dimer that catalyzes the first step in the production of the branched chain amino acids leucine, isoleucine, and valine. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028382	hsa-miR-32-5p	Sequencing	20371350
MIRT028382	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT040021	hsa-miR-615-3p	CLASH	23622248
MIRT041917	hsa-miR-484	CLASH	23622248
MIRT728217	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT728218	hsa-miR-92a-3p	HITS-CLIP	22473208

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004084	Function	Branched-chain-amino-acid transaminase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	28514442, 29568061
GO:0005739	Component	Mitochondrion	IBA	21873635
GO:0005739	Component	Mitochondrion	IDA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0009082	Process	Branched-chain amino acid biosynthetic process	IEA
GO:0009083	Process	Branched-chain amino acid catabolic process	TAS
GO:0009098	Process	Leucine biosynthetic process	IBA	21873635
GO:0009099	Process	Valine biosynthetic process	IBA	21873635
GO:0052654	Function	L-leucine transaminase activity	IEA
GO:0052655	Function	L-valine transaminase activity	IEA
GO:0052656	Function	L-isoleucine transaminase activity	IEA

Other IDs

• MIM: 113530
• HGNC: 977
• e!Ensembl: ENSG00000105552

Protein

• UniProt ID: O15382
• Protein name: Branched-chain-amino-acid aminotransferase, mitochondrial (BCAT(m)) (EC 2.6.1.42) (Placental protein 18) (PP18)
• Protein function: Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine (PubMed:25653144). May also function as a transporter of branched chain alpha-keto acids.
• PDB: 1EKF, 1EKP, 1EKV, 1KT8, 1KTA, 2A1H, 2HDK, 2HG8, 2HGW, 2HGX, 2HHF, 5BWR, 5BWT, 5BWU, 5BWV, 5BWW, 5BWX, 5CR5, 5HNE, 5I5S, 5I5T, 5I5U, 5I5V, 5I5W, 5I5X, 5I5Y, 5I60, 5MPR, 6PRX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01063	Aminotran_4	100 → 350	Amino-transferase class IV	Domain

• Sequence:

  MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKT
  FTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRP
  WLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSL
  GVSQPTRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLV
  QQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQS
  LLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIP
  TMENGPELILRFQKELKEIQYGIRAHEWMFPV

• Sequence length: 392