BANF1 (BAF nuclear assembly factor 1)

Gene

• Entrez ID: 8815
• Gene name: BAF nuclear assembly factor 1
• Gene symbol: BANF1
• Synonyms: BAF, BCRP1, D14S1460, NGPS
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, Jan 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT733314	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25658920

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000793	Component	Condensed chromosome	IEA
GO:0003677	Function	DNA binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	12163176, 22399800, 22770216, 25502805, 25910212, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	18005698, 22194607
GO:0005635	Component	Nuclear envelope	IEA
GO:0005654	Component	Nucleoplasm	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	18005698, 22194607
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007059	Process	Chromosome segregation	IBA	21873635
GO:0007084	Process	Mitotic nuclear envelope reassembly	TAS
GO:0008022	Function	Protein C-terminus binding	IMP	22399800
GO:0009615	Process	Response to virus	TAS	9465049
GO:0015074	Process	DNA integration	IEA
GO:0019899	Function	Enzyme binding	IPI	22399800
GO:0030261	Process	Chromosome condensation	IBA	21873635
GO:0042802	Function	Identical protein binding	IPI	16155580
GO:0042803	Function	Protein homodimerization activity	IPI	22399800
GO:0045071	Process	Negative regulation of viral genome replication	IDA	18005698
GO:0047485	Function	Protein N-terminus binding	IPI	22399800
GO:0051169	Process	Nuclear transport	TAS
GO:0075713	Process	Establishment of integrated proviral latency	TAS
GO:0097726	Function	LEM domain binding	IMP	22399800

Other IDs

• MIM: 603811
• HGNC: 17397
• e!Ensembl: ENSG00000175334

Protein

• UniProt ID: O75531
• Protein name: Barrier-to-autointegration factor (Breakpoint cluster region protein 1) [Cleaved into: Barrier-to-autointegration factor, N-terminally processed]
• Protein function: Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Contains 2 non-specific dsDNA-binding sites which may promote DNA cross-bridging. ; (Microbial infection) Exploited by retroviruses for inhibiting self-destructing autointegration of retroviral DNA, thereby promoting integration of viral DNA into the host chromosome. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD. ; (Microbial infection) In case of poxvirus infection, has an antiviral activity by blocking viral DNA replication.
• PDB: 1CI4, 1QCK, 2BZF, 2EZX, 2EZY, 2EZZ, 2ODG, 6GHD, 6RPR, 6UNT, 6URE, 6URJ, 6URK, 6URL, 6URN, 6URR, 6URZ, 6US0, 6US1, 6US7, 6USB, 6USD, 6USI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02961	BAF	1 → 88	Barrier to autointegration factor	Domain

• Sequence:

  MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFR
  EWLKDTCGANAKQSRDCFGCLREWCDAFL

• Sequence length: 89