BAIAP2 (BAR/IMD domain containing adaptor protein 2)

Gene

• Entrez ID: 10458
• Gene name: BAR/IMD domain containing adaptor protein 2
• Gene symbol: BAIAP2
• Synonyms: BAP2, FLAF3, IRSP53, WAML
• Chromosome: 17
• Chromosome location: 17q25.3
• Summary: The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Jan 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT037874	hsa-miR-455-3p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IEA
GO:0005515	Function	Protein binding	IPI	11157984, 11696321, 12598619, 15289329, 16189514, 17003044, 18448434, 19171758, 19460367, 19564905, 19933840, 20936779, 21311754, 24189400, 24658140, 25416956, 25519916, 25814554, 28514442, 31980649
GO:0005654	Component	Nucleoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	TAS	10343108
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA	19366662
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005912	Component	Adherens junction	HDA	25468996
GO:0007009	Process	Plasma membrane organization	IEA
GO:0007409	Process	Axonogenesis	TAS	10343108
GO:0008022	Function	Protein C-terminus binding	TAS	10343108
GO:0008093	Function	Cytoskeletal anchor activity	IEA
GO:0008286	Process	Insulin receptor signaling pathway	TAS	10343108
GO:0008360	Process	Regulation of cell shape	ISS
GO:0009617	Process	Response to bacterium	IMP	19366662
GO:0015629	Component	Actin cytoskeleton	IDA	19366662
GO:0030175	Component	Filopodium	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	IBA	21873635
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	19366662
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042802	Function	Identical protein binding	IPI	11696321, 14752106, 25416956
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0051017	Process	Actin filament bundle assembly	IBA	21873635
GO:0051017	Process	Actin filament bundle assembly	ISS
GO:0051764	Process	Actin crosslink formation	IBA	21873635
GO:0051764	Process	Actin crosslink formation	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070064	Function	Proline-rich region binding	IDA	19366662
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098641	Function	Cadherin binding involved in cell-cell adhesion	HDA	25468996
GO:2000251	Process	Positive regulation of actin cytoskeleton reorganization	IBA	21873635

Other IDs

• MIM: 605475
• HGNC: 947
• e!Ensembl: ENSG00000175866

Protein

• UniProt ID: Q9UQB8
• Protein name: Brain-specific angiogenesis inhibitor 1-associated protein 2 (BAI-associated protein 2) (BAI1-associated protein 2) (Protein BAP2) (Fas ligand-associated factor 3) (FLAF3) (Insulin receptor substrate p53/p58) (IRS-58) (IRSp53/58) (Insulin receptor substrate protein of 53 kDa) (IRSp53) (Insulin receptor substrate p53)
• Protein function: Adapter protein that links membrane-bound small G-proteins to cytoplasmic effector proteins. Necessary for CDC42-mediated reorganization of the actin cytoskeleton and for RAC1-mediated membrane ruffling. Involved in the regulation of the actin cytoskeleton by WASF family members and the Arp2/3 complex. Plays a role in neurite growth. Acts syngeristically with ENAH to promote filipodia formation. Plays a role in the reorganization of the actin cytoskeleton in response to bacterial infection. Participates in actin bundling when associated with EPS8, promoting filopodial protrusions.
• PDB: 1WDZ, 1Y2O, 2YKT, 3RNJ, 4JS0, 6BCR, 6BCY, 6BD1, 6BD2, 6BQT, 6ZEG, 6ZEI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08397	IMD	17 → 237	IRSp53/MIM homology domain	Family
  PF07653	SH3_2	378 → 435	Variant SH3 domain	Domain

• Sequence:

  MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMG
  ELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAAL
  KKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVS
  DGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERA
  VQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN
  GVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKT
  LPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK
  TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPA
  QTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGRE
  HGDGSARTLAGR

• Sequence length: 552