B3GALT6 (beta-1,3-galactosyltransferase 6)

Gene

• Entrez ID: 126792
• Gene name: Beta-1,3-galactosyltransferase 6
• Gene symbol: B3GALT6
• Synonyms: ALGAZ, EDSP2, EDSSPD2, SEMDJL1, beta3GalT6
• Chromosome: 1
• Chromosome location: 1p36.33
• Summary: The enzyme encoded by this intronless gene is a beta-1,3-galactosyltransferase found in the medial Golgi apparatus, where it catalyzes the transfer of galactose from UDP-galactose to substrates containing a terminal beta-linked galactose moiety. The encoded enzyme has a particular affinity for galactose-beta-1,4-xylose found in the linker region of glycosamines. This enzyme is required for glycosaminoglycan synthesis. [provided by RefSeq, Jun 2013]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0005794	Component	Golgi apparatus	IMP	29443383
GO:0005797	Component	Golgi medial cisterna	IDA	11551958
GO:0006024	Process	Glycosaminoglycan biosynthetic process	IBA	21873635
GO:0006024	Process	Glycosaminoglycan biosynthetic process	IMP	11551958
GO:0006486	Process	Protein glycosylation	IEA
GO:0008499	Function	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity	IEA
GO:0015012	Process	Heparan sulfate proteoglycan biosynthetic process	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016021	Component	Integral component of membrane	IEA
GO:0018215	Process	Protein phosphopantetheinylation	IEA
GO:0030166	Process	Proteoglycan biosynthetic process	IMP	29443383
GO:0030203	Process	Glycosaminoglycan metabolic process	TAS
GO:0030206	Process	Chondroitin sulfate biosynthetic process	IEA
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0035250	Function	UDP-galactosyltransferase activity	IBA	21873635
GO:0035250	Function	UDP-galactosyltransferase activity	IDA	11551958
GO:0047220	Function	Galactosylxylosylprotein 3-beta-galactosyltransferase activity	IMP	29443383
GO:0047220	Function	Galactosylxylosylprotein 3-beta-galactosyltransferase activity	TAS

Other IDs

• MIM: 615291
• HGNC: 17978
• e!Ensembl: ENSG00000176022

Protein

• UniProt ID: Q96L58
• Protein name: Beta-1,3-galactosyltransferase 6 (Beta-1,3-GalTase 6) (Beta3Gal-T6) (Beta3GalT6) (EC 2.4.1.134) (GAG GalTII) (Galactosyltransferase II) (Galactosylxylosylprotein 3-beta-galactosyltransferase) (UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6)
• Protein function: Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. Has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. Has no activity towards substrates with terminal glucosamine or galactosamine residues.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01762	Galactosyl_T	71 → 260	Galactosyltransferase	Family

• Sequence:

  MKLLRRAWRRRAALGLGTLALCGAALLYLARCAAEPGDPRAMSGRSPPPPAPARAAAFLA
  VLVASAPRAAERRSVIRSTWLARRGAPGDVWARFAVGTAGLGAEERRALEREQARHGDLL
  LLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDSFARLDALLAELRAREPARRRR
  LYWGFFSGRGRVKPGGRWREAAWQLCDYYLPYALGGGYVLSADLVHYLRLSRDYLRAWHS
  EDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLC
  KREVQLRLSYVYDWSAPPSQCCQRREGIP

• Sequence length: 329