ATP1B2 (ATPase Na+/K+ transporting subunit beta 2)

Gene

• Entrez ID: 482
• Gene name: ATPase Na+/K+ transporting subunit beta 2
• Gene symbol: ATP1B2
• Synonyms: AMOG
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019110	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001671	Function	ATPase activator activity	IBA	21873635
GO:0001671	Function	ATPase activator activity	IDA	10636900, 19542013
GO:0001895	Process	Retina homeostasis	ISS
GO:0001917	Component	Photoreceptor inner segment	ISS
GO:0005515	Function	Protein binding	IPI	11027149
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IBA	21873635
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IDA	10636900, 19542013
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	ISS
GO:0006883	Process	Cellular sodium ion homeostasis	IBA	21873635
GO:0006883	Process	Cellular sodium ion homeostasis	IDA	10636900, 19542013
GO:0009897	Component	External side of plasma membrane	ISS
GO:0010248	Process	Establishment or maintenance of transmembrane electrochemical gradient	IEA
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	ISS
GO:0016324	Component	Apical plasma membrane	IDA	11193188
GO:0016328	Component	Lateral plasma membrane	IDA	11193188
GO:0021670	Process	Lateral ventricle development	ISS
GO:0021678	Process	Third ventricle development	ISS
GO:0021944	Process	Neuronal-glial interaction involved in hindbrain glial-mediated radial cell migration	ISS
GO:0030007	Process	Cellular potassium ion homeostasis	IBA	21873635
GO:0030007	Process	Cellular potassium ion homeostasis	IDA	10636900, 19542013
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	10636900, 19542013
GO:0031253	Component	Cell projection membrane	ISS
GO:0031589	Process	Cell-substrate adhesion	ISS	12887597
GO:0032781	Process	Positive regulation of ATPase activity	IDA	10636900
GO:0034220	Process	Ion transmembrane transport	TAS
GO:0036376	Process	Sodium ion export across plasma membrane	IBA	21873635
GO:0036376	Process	Sodium ion export across plasma membrane	IDA	10636900, 19542013
GO:0044298	Component	Cell body membrane	ISS
GO:0045494	Process	Photoreceptor cell maintenance	ISS
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0050821	Process	Protein stabilization	IDA	10636900
GO:0050900	Process	Leukocyte migration	TAS
GO:0051117	Function	ATPase binding	IPI	10636900
GO:0061744	Process	Motor behavior	ISS
GO:0071944	Component	Cell periphery	ISS	15294280
GO:0086009	Process	Membrane repolarization	IDA	19542013
GO:0086064	Process	Cell communication by electrical coupling involved in cardiac conduction	TAS	19683723
GO:0097449	Component	Astrocyte projection	IDA	12887597
GO:0097449	Component	Astrocyte projection	ISS
GO:0097450	Component	Astrocyte end-foot	ISS
GO:0098984	Component	Neuron to neuron synapse	ISS
GO:0120036	Process	Plasma membrane bounded cell projection organization	ISS
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653
GO:1901018	Process	Positive regulation of potassium ion transmembrane transporter activity	IDA	10636900
GO:1903278	Process	Positive regulation of sodium ion export across plasma membrane	IDA	10636900
GO:1903288	Process	Positive regulation of potassium ion import across plasma membrane	IDA	10636900
GO:1903779	Process	Regulation of cardiac conduction	TAS
GO:1903976	Process	Negative regulation of glial cell migration	ISS	12887597
GO:1990573	Process	Potassium ion import across plasma membrane	IBA	21873635
GO:1990573	Process	Potassium ion import across plasma membrane	IDA	10636900, 19542013

Other IDs

• MIM: 182331
• HGNC: 805
• e!Ensembl: ENSG00000129244

Protein

• UniProt ID: P14415
• Protein name: Sodium/potassium-transporting ATPase subunit beta-2 (Adhesion molecule in glia) (AMOG) (Sodium/potassium-dependent ATPase subunit beta-2)
• Protein function: This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-2 subunit is not known.; Mediates cell adhesion of neurons and astrocytes, and promotes neurite outgrowth.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00287	Na_K-ATPase	7 → 283	Sodium / potassium ATPase beta chain	Family

• Sequence:

  MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMW
  VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDS
  IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFI
  KMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYT
  QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

• Sequence length: 290