ATP1A4 (ATPase Na+/K+ transporting subunit alpha 4)

Gene

• Entrez ID: 480
• Gene name: ATPase Na+/K+ transporting subunit alpha 4
• Gene symbol: ATP1A4
• Synonyms: ATP1A1, ATP1AL2
• Chromosome: 1
• Chromosome location: 1q23.2
• Summary: The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 4 subunit. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005391	Function	P-type sodium:potassium-exchanging ATPase activity	IBA	21873635
GO:0005391	Function	P-type sodium:potassium-exchanging ATPase activity	IGI	16861705
GO:0005391	Function	P-type sodium:potassium-exchanging ATPase activity	ISS
GO:0005391	Function	P-type sodium:potassium-exchanging ATPase activity	TAS	7809153
GO:0005515	Function	Protein binding	IPI	16861705
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	NAS	30280653
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	NAS	7809153
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IPI	16861705
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	TAS	7809153
GO:0006811	Process	Ion transport	NAS	30280653
GO:0006813	Process	Potassium ion transport	TAS	7809153
GO:0006814	Process	Sodium ion transport	TAS	7809153
GO:0006883	Process	Cellular sodium ion homeostasis	IBA	21873635
GO:0007166	Process	Cell surface receptor signaling pathway	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0009566	Process	Fertilization	IEA
GO:0010248	Process	Establishment or maintenance of transmembrane electrochemical gradient	IEA
GO:0019829	Function	ATPase-coupled cation transmembrane transporter activity	IGI	16861705
GO:0019900	Function	Kinase binding	ISS
GO:0030007	Process	Cellular potassium ion homeostasis	IBA	21873635
GO:0030317	Process	Flagellated sperm motility	IDA	12112599
GO:0030317	Process	Flagellated sperm motility	IMP	16861705
GO:0030641	Process	Regulation of cellular pH	IDA	12112599
GO:0034220	Process	Ion transmembrane transport	TAS
GO:0035725	Process	Sodium ion transmembrane transport	IGI	16861705
GO:0035725	Process	Sodium ion transmembrane transport	ISS
GO:0036376	Process	Sodium ion export across plasma membrane	IBA	21873635
GO:0042391	Process	Regulation of membrane potential	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IGI	16861705
GO:0071805	Process	Potassium ion transmembrane transport	ISS
GO:0097225	Component	Sperm midpiece	IDA	16861705
GO:0097733	Component	Photoreceptor cell cilium	IDA	26373354
GO:0120200	Component	Rod photoreceptor outer segment	IDA	26373354
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653
GO:1902600	Process	Proton transmembrane transport	IBA	21873635
GO:1902600	Process	Proton transmembrane transport	TAS	7809153
GO:1903779	Process	Regulation of cardiac conduction	TAS
GO:1990573	Process	Potassium ion import across plasma membrane	IBA	21873635

Other IDs

• MIM: 607321
• HGNC: 14073
• e!Ensembl: ENSG00000132681

Protein

• UniProt ID: Q13733
• Protein name: Sodium/potassium-transporting ATPase subunit alpha-4 (Na(+)/K(+) ATPase alpha-4 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-4)
• Protein function: This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients. Plays a role in sperm motility.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00690	Cation_ATPase_N	51 → 119	Cation transporter/ATPase, N-terminus	Domain
  PF00122	E1-E2_ATPase	171 → 362		Family
  PF13246	Cation_ATPase	434 → 528		Family
  PF00689	Cation_ATPase_C	805 → 1014	Cation transporting ATPase, C-terminus	Family

• Sequence:

  MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELS
  TKYSVDLTKGHSHQRAKEILTRGGPNTVTPPPTTPEWVKFCKQLFGGFSLLLWTGAILCF
  VAYSIQIYFNEEPTKDNLYLSIVLSVVVIVTGCFSYYQEAKSSKIMESFKNMVPQQALVI
  RGGEKMQINVQEVVLGDLVEIKGGDRVPADLRLISAQGCKVDNSSLTGESEPQSRSPDFT
  HENPLETRNICFFSTNCVEGTARGIVIATGDSTVMGRIASLTSGLAVGQTPIAAEIEHFI
  HLITVVAVFLGVTFFALSLLLGYGWLEAIIFLIGIIVANVPEGLLATVTVCLTLTAKRMA
  RKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDMTVYEADTTEEQTGKTFT
  KSSDTWFMLARIAGLCNRADFKANQEILPIAKRATTGDASESALLKFIEQSYSSVAEMRE
  KNPKVAEIPFNSTNKYQMSIHLREDSSQTHVLMMKGAPERILEFCSTFLLNGQEYSMNDE
  MKEAFQNAYLELGGLGERVLGFCFLNLPSSFSKGFPFNTDEINFPMDNLCFVGLISMIDP
  PRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETAEEVAARLKIPISK
  VDASAAKAIVVHGAELKDIQSKQLDQILQNHPEIVFARTSPQQKLIIVEGCQRLGAVVAV
  TGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKK
  SIMYTLTSNIPEITPFLMFIILGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMKR
  LPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKY
  LNDLEDSYGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVL
  IFGILEETLLAAFLSYTPGMDVALRMYPLKITWWLCAIPYSILIFVYDEIRKLLIRQHPD
  GWVERETYY

• Sequence length: 1029