ATF6B (activating transcription factor 6 beta)

Gene

• Entrez ID: 1388
• Gene name: Activating transcription factor 6 beta
• Gene symbol: ATF6B
• Synonyms: CREB-RP, CREBL1, G13
• Chromosome: 6
• Chromosome location: 6p21.32
• Summary: The protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. The protein is normally found in the membrane of the endoplasmic reticulum; however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004191	hsa-miR-197-3p	Microarray	16822819
MIRT645428	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT645429	hsa-miR-4646-3p	HITS-CLIP	23824327
MIRT645430	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT645431	hsa-miR-4433b-5p	HITS-CLIP	23824327
MIRT645432	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT645433	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT645434	hsa-miR-623	HITS-CLIP	23824327
MIRT645435	hsa-miR-1260b	HITS-CLIP	23824327
MIRT645436	hsa-miR-1260a	HITS-CLIP	23824327
MIRT645437	hsa-miR-4433a-5p	HITS-CLIP	23824327
MIRT645438	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT645439	hsa-miR-4780	HITS-CLIP	23824327
MIRT645440	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT645441	hsa-miR-3646	HITS-CLIP	23824327
MIRT645442	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT645443	hsa-miR-3662	HITS-CLIP	23824327
MIRT645444	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT645445	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT645446	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT645447	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT645448	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT645449	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT645450	hsa-miR-548ae-3p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	11256944
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	11256944
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	14973138
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11256944
GO:0005515	Function	Protein binding	IPI	12445808
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	11256944
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	11256944
GO:0005794	Component	Golgi apparatus	TAS	22013210
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	8586413
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	NAS	11256944
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	TAS	22013210
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IBA	21873635
GO:0032993	Component	Protein-DNA complex	IDA	11256944
GO:0035497	Function	CAMP response element binding	IEA
GO:0036500	Process	ATF6-mediated unfolded protein response	TAS	22013210
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	14973138
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	11256944
GO:1903892	Process	Negative regulation of ATF6-mediated unfolded protein response	IDA	9837962
GO:1990440	Process	Positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IDA	11256944
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 600984
• HGNC: 2349
• e!Ensembl: ENSG00000213676

Protein

• UniProt ID: Q99941
• Protein name: Cyclic AMP-dependent transcription factor ATF-6 beta (cAMP-dependent transcription factor ATF-6 beta) (Activating transcription factor 6 beta) (ATF6-beta) (Protein G13) (cAMP response element-binding protein-related protein) (Creb-rp) (cAMP-responsive element-binding protein-like 1) [Cleaved into: Processed cyclic AMP-dependent transcription factor ATF-6 beta]
• Protein function: [Cyclic AMP-dependent transcription factor ATF-6 beta]: Precursor of the transcription factor form (Processed cyclic AMP-dependent transcription factor ATF-6 beta), which is embedded in the endoplasmic reticulum membrane (PubMed:11256944). Endoplasmic reticulum stress promotes processing of this form, releasing the transcription factor form that translocates into the nucleus, where it activates transcription of genes involved in the unfolded protein response (UPR) (PubMed:11256944). ; [Processed cyclic AMP-dependent transcription factor ATF-6 beta]: Transcription factor that acts in the unfolded protein response (UPR) pathway by activating UPR target genes induced during ER stress (PubMed:11256944). Binds DNA on the 5'-CCAC[GA]-3' half of the ER stress response element (ERSE) (5'-CCAATN(9)CCAC[GA]-3') when NF-Y is bound to ERSE (PubMed:11256944).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00170	bZIP_1	323 → 389	bZIP transcription factor	Coiled-coil

• Sequence:

  MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDG
  SSLDVGMDVSPSEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSEALGVGE
  VLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQTKIEPVSPCSSVNSEASL
  LSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTR
  KPPLQPKPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLP
  RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
  LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
  SAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQPSFSNLTAF
  PGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKS
  QPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRD
  HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTS
  TVPPSLRKQPSPTPGNATGGPLPVSAASQAHQASHQPLYLNHP

• Sequence length: 703