ATF2 (activating transcription factor 2)

Gene

• Entrez ID: 1386
• Gene name: Activating transcription factor 2
• Gene symbol: ATF2
• Synonyms: CRE-BP1, CREB-2, CREB2, HB16, TREB7
• Chromosome: 2
• Chromosome location: 2q31.1
• Summary: This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions This prote

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016080	hsa-miR-374b-5p	Sequencing	20371350
MIRT019034	hsa-miR-335-5p	Microarray	18185580
MIRT031029	hsa-miR-21-5p	Microarray	18591254
MIRT031297	hsa-miR-19b-3p	Sequencing	20371350
MIRT051336	hsa-miR-15a-5p	CLASH	23622248
MIRT732803	hsa-miR-26b-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32476275
MIRT733466	hsa-miR-451a	Western blotting, Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR	32710569
MIRT804238	hsa-miR-1226	CLIP-seq
MIRT804239	hsa-miR-1303	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT804242	hsa-miR-3591-3p	CLIP-seq
MIRT804243	hsa-miR-3609	CLIP-seq
MIRT804244	hsa-miR-3663-3p	CLIP-seq
MIRT804245	hsa-miR-3941	CLIP-seq
MIRT804246	hsa-miR-4477a	CLIP-seq
MIRT804247	hsa-miR-4643	CLIP-seq
MIRT804248	hsa-miR-466	CLIP-seq
MIRT804249	hsa-miR-4672	CLIP-seq
MIRT804250	hsa-miR-4729	CLIP-seq
MIRT804251	hsa-miR-4789-3p	CLIP-seq
MIRT804252	hsa-miR-545	CLIP-seq
MIRT804253	hsa-miR-548ah	CLIP-seq
MIRT804254	hsa-miR-548n	CLIP-seq
MIRT804255	hsa-miR-548t	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT804258	hsa-miR-634	CLIP-seq
MIRT804259	hsa-miR-802	CLIP-seq
MIRT1937507	hsa-miR-204	CLIP-seq
MIRT1937508	hsa-miR-211	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT1937510	hsa-miR-224	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT1937512	hsa-miR-3616-5p	CLIP-seq
MIRT1937513	hsa-miR-3647-5p	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT1937515	hsa-miR-4446-5p	CLIP-seq
MIRT1937516	hsa-miR-4755-5p	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT1937524	hsa-miR-573	CLIP-seq
MIRT1937525	hsa-miR-623	CLIP-seq
MIRT1937507	hsa-miR-204	CLIP-seq
MIRT1937508	hsa-miR-211	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT1937510	hsa-miR-224	CLIP-seq
MIRT2177150	hsa-miR-3124-3p	CLIP-seq
MIRT1937512	hsa-miR-3616-5p	CLIP-seq
MIRT1937513	hsa-miR-3647-5p	CLIP-seq
MIRT2177151	hsa-miR-3663-5p	CLIP-seq
MIRT1937515	hsa-miR-4446-5p	CLIP-seq
MIRT1937516	hsa-miR-4755-5p	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT2177152	hsa-miR-502-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT1937524	hsa-miR-573	CLIP-seq
MIRT2177153	hsa-miR-582-3p	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT1937525	hsa-miR-623	CLIP-seq
MIRT804239	hsa-miR-1303	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT2480440	hsa-miR-1205	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT2177150	hsa-miR-3124-3p	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT2177151	hsa-miR-3663-5p	CLIP-seq
MIRT2480441	hsa-miR-3665	CLIP-seq
MIRT2480442	hsa-miR-3688-3p	CLIP-seq
MIRT2480443	hsa-miR-4261	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT2480444	hsa-miR-4694-3p	CLIP-seq
MIRT2480445	hsa-miR-4738-3p	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT2480446	hsa-miR-522	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT2177153	hsa-miR-582-3p	CLIP-seq
MIRT2480447	hsa-miR-657	CLIP-seq
MIRT2480440	hsa-miR-1205	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT2480441	hsa-miR-3665	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT2480447	hsa-miR-657	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
DDIT3	Repression	16164412
NR3C1	Repression	17016446
RB1	Unknown	7702750
SP1	Unknown	2145272

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	23729669
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	2516827
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IC	19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	2196176
GO:0001102	Function	RNA polymerase II activating transcription factor binding	IPI	19861239
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16300731, 18671972, 19861239
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	8798441
GO:0004402	Function	Histone acetyltransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	8440710, 9748258, 10327051, 15105425, 15916964, 16511568, 18397884, 20102225, 20116378, 20195357, 20511396, 22439931, 24705354, 25416956, 25609649, 28514442, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	8798441, 18397884, 19861239, 21098032, 22304920
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	22304920
GO:0005741	Component	Mitochondrial outer membrane	IDA	22304920
GO:0006355	Process	Regulation of transcription, DNA-templated	IMP	22304920
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	19861239
GO:0006970	Process	Response to osmotic stress	IDA	21098032
GO:0006974	Process	Cellular response to DNA damage stimulus	IDA	22304920
GO:0006974	Process	Cellular response to DNA damage stimulus	IMP	15916964
GO:0008140	Function	CAMP response element binding protein binding	IDA	19861239
GO:0009414	Process	Response to water deprivation	IEA
GO:0010485	Function	H4 histone acetyltransferase activity	IDA	10821277
GO:0010628	Process	Positive regulation of gene expression	IMP	28977001
GO:0016525	Process	Negative regulation of angiogenesis	IMP	28977001
GO:0019901	Function	Protein kinase binding	IPI	21098032
GO:0031573	Process	Intra-S DNA damage checkpoint	IMP	15916964
GO:0032915	Process	Positive regulation of transforming growth factor beta2 production	IEA
GO:0035497	Function	CAMP response element binding	IBA	21873635
GO:0035497	Function	CAMP response element binding	IDA	19861239, 23729669
GO:0035861	Component	Site of double-strand break	IDA	15916964
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043967	Process	Histone H4 acetylation	IDA	10821277
GO:0043969	Process	Histone H2B acetylation	IDA	10821277
GO:0044013	Function	H2B histone acetyltransferase activity	IDA	10821277
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16300731, 18671972
GO:0046872	Function	Metal ion binding	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	TAS
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	10821277
GO:0060612	Process	Adipose tissue development	IEA
GO:0097186	Process	Amelogenesis	IEA
GO:0110024	Process	Positive regulation of cardiac muscle myoblast proliferation	IDA	22982025
GO:1902110	Process	Positive regulation of mitochondrial membrane permeability involved in apoptotic process	IMP	22304920
GO:1902562	Component	H4 histone acetyltransferase complex	IDA	10821277
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 123811
• HGNC: 784
• e!Ensembl: ENSG00000115966

Protein

• UniProt ID: P15336
• Protein name: Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (cAMP response el
• Protein function: Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequ
• PDB: 1BHI, 1T2K, 4H36, 6ZQS, 6ZR5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00170	bZIP_1	350 → 413	bZIP transcription factor	Coiled-coil

• Sequence:

  MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
  DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
  SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
  SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
  HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
  GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
  RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
  TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
  ADQSTEPALSQIVMAPSSQSQPSGS

• Sequence length: 505