ASRGL1 (asparaginase and isoaspartyl peptidase 1)

Gene

• Entrez ID: 80150
• Gene name: Asparaginase and isoaspartyl peptidase 1
• Gene symbol: ASRGL1
• Synonyms: ALP, ALP1, CRASH
• Chromosome: 11
• Chromosome location: 11q12.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024570	hsa-miR-215-5p	Microarray	19074876
MIRT026301	hsa-miR-192-5p	Microarray	19074876
MIRT030736	hsa-miR-21-5p	Microarray	18591254

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001917	Component	Photoreceptor inner segment	ISS
GO:0003948	Function	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity	IDA	19839645
GO:0004067	Function	Asparaginase activity	IBA	21873635
GO:0004067	Function	Asparaginase activity	IDA	19839645
GO:0004067	Function	Asparaginase activity	IMP	27106100
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	27106100
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006559	Process	L-phenylalanine catabolic process	TAS
GO:0008798	Function	Beta-aspartyl-peptidase activity	IBA	21873635
GO:0008798	Function	Beta-aspartyl-peptidase activity	IDA	19839645
GO:0033345	Process	Asparagine catabolic process via L-aspartate	IBA	21873635
GO:0033345	Process	Asparagine catabolic process via L-aspartate	IDA	19839645
GO:0033345	Process	Asparagine catabolic process via L-aspartate	ISS

Other IDs

• MIM: 609212
• HGNC: 16448
• e!Ensembl: ENSG00000162174

Protein

• UniProt ID: Q7L266
• Protein name: Isoaspartyl peptidase/L-asparaginase (EC 3.4.19.5) (EC 3.5.1.1) (Asparaginase-like protein 1) (Beta-aspartyl-peptidase) (Isoaspartyl dipeptidase) (L-asparagine amidohydrolase) [Cleaved into: Isoaspartyl peptidase/L-asparaginase alpha chain; Isoaspartyl peptidase/L-asparaginase beta chain]
• Protein function: Has both L-asparaginase and beta-aspartyl peptidase activity. May be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. Is highly active with L-Asp beta-methyl ester. Besides, has catalytic activity toward beta-aspartyl dipeptides and their methyl esters, including beta-L-Asp-L-Phe, beta-L-Asp-L-Phe methyl ester (aspartame), beta-L-Asp-L-Ala, beta-L-Asp-L-Leu and beta-L-Asp-L-Lys. Does not have aspartylglucosaminidase activity and is inactive toward GlcNAc-L-Asn. Likewise, has no activity toward glutamine.
• PDB: 3TKJ, 4ET0, 4O0C, 4O0D, 4O0E, 4O0F, 4O0G, 4O0H, 4OSX, 4OSY, 4PVP, 4PVQ, 4PVR, 4PVS, 4ZM9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01112	Asparaginase_2	3 → 296	Asparaginase	Domain

• Sequence:

  MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPE
  FNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQ
  GAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNV
  AYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQ
  GKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPD
  DTTITDLP

• Sequence length: 308