ASNS (asparagine synthetase (glutamine-hydrolyzing))

Gene

• Entrez ID: 440
• Gene name: Asparagine synthetase (glutamine-hydrolyzing)
• Gene symbol: ASNS
• Synonyms: ASNSD, TS11
• Chromosome: 7
• Chromosome location: 7q21.3
• Summary: The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020723	hsa-miR-155-5p	Proteomics	18668040
MIRT029495	hsa-miR-26b-5p	Microarray	19088304
MIRT031665	hsa-miR-16-5p	Proteomics	18668040
MIRT040401	hsa-miR-615-3p	CLASH	23622248
MIRT047059	hsa-miR-183-5p	CLASH	23622248
MIRT050405	hsa-miR-23a-3p	CLASH	23622248
MIRT050820	hsa-miR-17-5p	CLASH	23622248

Transcription factors

Transcription factor	Regulation	Reference
ATF3	Activation	12881527
ATF3	Unknown	15385533
ATF4	Activation	11960987;16164412;17276738
ATF4	Unknown	15385533;23403946
CEBPB	Unknown	15385533
DDIT3	Repression	18940792
WWTR1	Repression	22470139

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001889	Process	Liver development	IEA
GO:0004066	Function	Asparagine synthase (glutamine-hydrolyzing) activity	IBA	21873635
GO:0004066	Function	Asparagine synthase (glutamine-hydrolyzing) activity	IDA	2564390, 2569668, 2573597, 2886907, 16023613
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006529	Process	Asparagine biosynthetic process	IBA	21873635
GO:0006529	Process	Asparagine biosynthetic process	IC	2564390
GO:0006529	Process	Asparagine biosynthetic process	IDA	2573597
GO:0006541	Process	Glutamine metabolic process	IEA
GO:0008652	Process	Cellular amino acid biosynthetic process	TAS
GO:0009416	Process	Response to light stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0031427	Process	Response to methotrexate	IEA
GO:0032354	Process	Response to follicle-stimulating hormone	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0036499	Process	PERK-mediated unfolded protein response	TAS
GO:0042149	Process	Cellular response to glucose starvation	IDA	10085239
GO:0042802	Function	Identical protein binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17409444
GO:0043200	Process	Response to amino acid	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IDA	2569668
GO:0070981	Process	L-asparagine biosynthetic process	IEA

Other IDs

• MIM: 108370
• HGNC: 753
• e!Ensembl: ENSG00000070669

Protein

• UniProt ID: P08243
• Protein name: Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4) (Cell cycle control protein TS11) (Glutamine-dependent asparagine synthetase)
• PDB: 6GQ3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13537	GATase_7	47 → 166	Glutamine amidotransferase domain	Domain
  PF00733	Asn_synthase	234 → 395	Asparagine synthase	Domain
  PF00733	Asn_synthase	381 → 547	Asparagine synthase	Domain

• Sequence:

  MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
  PIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGV
  FAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPF
  LPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFN
  NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
  KVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
  IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
  LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
  WFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPK
  WINATDPSARTLTHYKSAVKA

• Sequence length: 561